H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
Locus viewLocus view Protein view Protein view G-integraG-integra DiseaseInfo ViewerDiseaseInfo Viewer H-ANGELH-ANGEL EvolaEvola PPI viewerPPI view Gene Family/GroupGene Family/Group Hyperlink managemnet system (All databases)Hyperlink MS
H-Invitational ID: HIT000000003 Accession number: AB002294 Created date: 26-Mar-2013 Last modified: 20-Apr-2012
Definition: Similar to Uncharacterized protein; Fragment;
 
 

Transcript original information
Accession number AB002294.1
CAGE tag ID NA
EST ID NA
Clone Number HF0260
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ZNF646) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ZNF646);
Sequence data provider Provider:KDRI
Annotation project H-Invitational FLcDNA
Length of cDNA 7604[bp] (No. of exon:1)[A:1670 T:1378 G:2261 C:2295]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type brain
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0012978
Genomic location  G-integra Help Chromosome 16
Location 16p11.2
Position 31087223- 31094826
Strand +
Possible duplicated location(s) NA
Gene structure 1 exon(s)
Database links RefSeq NM_014699
Ensembl ENST00000300850ENST00000394979ENST00000428260ENST00000439353
Entrez Gene Entrez Gene ID:9726
KEGG GENES KEGG GENES(9726)
GeneCard GeneCardZNF646*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000045190
Predicted CDS 424..5913;  1829[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.823
Database links RefSeq NA
UniProt O15015
CCDS NA

Motif information
ORF

length(1829),orf(424:5913)
MEDTPPSLSCSDCQRHFPSLPELSRHRELLHPSPNQDSEEADSIPRPYRC
QQCGRGYRHPGSLVNHRRTHETGLFPCTTCGKDFSNPMALKSHMRTHAPE
GRRRHRPPRPKEATPHLQGETVSTDSWGQRLGSSEGWENQTKHTEETPDC
ESVPDPRAASGTWEDLPTRQREGLASHPGPEDGADGWGPSTNSARAPPLP
IPASSLLSNLEQYLAESVVNFTGGQEPTQSPPAEEERRYKCSQCGKTYKH
AGSLTNHRQSHTLGIYPCAICFKEFSNLMALKNHSRLHAQYRPYHCPHCP
RVFRLPRELLEHQQSHEGERQEPRWEEKGMPTTNGHTDESSQDQLPSAQM
LNGSAELSTSGELEDSGLEEYRPFRCGDCGRTYRHAGSLINHRKSHQTGV
YPCSLCSKQLFNAAALKNHVRAHHRPRQGVGENGQPSVPPAPLLLAETTH
KEEEDPTTTLDHRPYKCSECGRAYRHRGSLVNHRHSHRTGEYQCSLCPRK
YPNLMALRNHVRVHCKAARRSADIGAEGAPSHLKVELPPDPVEAEAAPHT
DQDHVCKHEEEATDITPAADKTAAHICSICGLLFEDAESLERHGLTHGAG
EKENSRTETTMSPPRAFACRDCGKSYRHSGSLINHRQTHQTGDFSCGACA
KHFHTMAAMKNHLRRHSRRRSRRHRKRAGGASGGREAKLLAAESWTRELE
DNEGLESPQDPSGESPHGAEGNLESDGDCLQAESEGDKCGLERDETHFQG
DKESGGTGEGLERKDASLLDNLDIPGEEGGGTHFCDSLTGVDEDQKPATG
QPNSSSHSANAVTGWQAGAAHTCSDCGHSFPHATGLLSHRPCHPPGIYQC
SLCPKEFDSLPALRSHFQNHRPGEATSAQPFLCCLCGMIFPGRAGYRLHR
RQAHSSSGMTEGSEEEGEEEGVAEAAPARSPPLQLSEAELLNQLQREVEA
LDSAGYGHICGCCGQTYDDLGSLERHHQSQSSGTTADKAPSPLGVAGDAM
...
a.a.
length
InterPro Name
length(24), motif(8:31) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(29), motif(8:36) 29 IPR007087 Zinc finger, C2H2-type [Domain]
length(22), motif(10:31) 22 IPR007087 Zinc finger, C2H2-type [Domain]
length(25), motif(46:70) 25 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(23), motif(48:70) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(23), motif(48:70) 23 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(50:70) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(23), motif(75:97) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(24), motif(75:98) 24 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(23), motif(75:97) 23 IPR007087 Zinc finger, C2H2-type [Domain]
length(28), motif(75:102) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(77:97) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(28), motif(235:262) 28 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(23), motif(239:261) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(24), motif(239:262) 24 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(241:261) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(23), motif(266:288) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(266:293) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(268:288) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(41), motif(280:320) 41 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(23), motif(294:316) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(294:321) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(296:316) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(25), motif(372:396) 25 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(23), motif(374:396) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(29), motif(374:402) 29 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(376:396) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(23), motif(401:423) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(401:428) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(22), motif(403:424) 22 IPR007087 Zinc finger, C2H2-type [Domain]
length(25), motif(463:487) 25 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(23), motif(465:487) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(23), motif(465:487) 23 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(467:487) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(23), motif(492:514) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(23), motif(492:514) 23 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(494:514) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(23), motif(575:597) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(575:602) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(577:597) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(26), motif(615:640) 26 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(23), motif(617:639) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(23), motif(617:639) 23 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(619:639) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(23), motif(644:666) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(644:671) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(646:666) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(23), motif(821:843) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(23), motif(821:843) 23 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(823:843) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(23), motif(848:870) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(848:875) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(850:870) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(24), motif(881:904) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(29), motif(881:909) 29 IPR007087 Zinc finger, C2H2-type [Domain]
length(22), motif(883:904) 22 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(958:978) 21 IPR015880 Zinc finger, C2H2-like [Domain]
length(25), motif(1050:1074) 25 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(23), motif(1052:1074) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(23), motif(1052:1074) 23 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(1054:1074) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(23), motif(1079:1101) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(1079:1106) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(1081:1101) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(26), motif(1200:1225) 26 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(23), motif(1203:1225) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(23), motif(1203:1225) 23 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(1205:1225) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(23), motif(1230:1252) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(1230:1257) 28 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(28), motif(1230:1257) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(1232:1252) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(23), motif(1258:1280) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(24), motif(1258:1281) 24 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(28), motif(1258:1285) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(1260:1280) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(27), motif(1296:1322) 27 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(23), motif(1299:1321) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(23), motif(1299:1321) 23 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(1301:1321) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(27), motif(1325:1351) 27 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(23), motif(1326:1348) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(1326:1353) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(1328:1348) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(23), motif(1364:1386) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(1364:1391) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(1366:1386) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(1531:1551) 21 IPR015880 Zinc finger, C2H2-like [Domain]
length(23), motif(1557:1579) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(21), motif(1559:1579) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(37), motif(1572:1608) 37 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(23), motif(1585:1607) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(1585:1612) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(1587:1607) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(28), motif(1674:1701) 28 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(23), motif(1677:1699) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(24), motif(1677:1700) 24 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(1679:1699) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(23), motif(1704:1726) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(1704:1731) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(1706:1726) 21 IPR007087 Zinc finger, C2H2-type [Domain]
length(38), motif(1718:1755) 38 IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding [Domain]
length(23), motif(1732:1754) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(1732:1759) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(22), motif(1733:1754) 22 IPR007087 Zinc finger, C2H2-type [Domain]
length(23), motif(1761:1783) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(1761:1788) 28 IPR007087 Zinc finger, C2H2-type [Domain]
length(21), motif(1763:1783) 21 IPR007087 Zinc finger, C2H2-type [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000000003
H-Inv cluster ID Locus viewHIX0012978
Accession number AB002294.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Uncharacterized protein; Fragment;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (F1PZT2)  [Identity/coverage = 98.113%/100.0%] to Canis familiaris (Dog) (Canis lupus familiaris). protein.
Experimental evidence Protein evidence
PubMed ID 16341006ALL
Gene family/group Gene family H-Inv gene family/group ID HIF0000005
Gene family/group name Putative Zinc finger, C2H2-type (IPR007087).
Evidence motif (InterPro) ID IPR007087
Gene symbol/name HGNC symbol ZNF646
HGNC aliases NA
HGNC name zinc finger protein 646
DDBJ KIAA0296
UniProt ZNF646
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000045190
No. of interaction 31
Interaction partner(s) HIP000004641HIP000019806HIP000023088HIP000027985HIP000030139HIP000030139HIP000040979HIP000040979HIP000046539HIP000050218HIP000051100HIP000058525HIP000060909HIP000060909HIP000061444HIP000065024HIP000066804HIP000076726HIP000076726HIP000083362HIP000087753HIP000090103HIP000092761HIP000097588HIP000099677HIP000103357HIP000103357HIP000104459HIP000112902HIP000174448HIP000436453
BIND 144515;  176588;  177534;  295656;  55271;  55314; 
DIP 102977E; 
MINT MINT-17109;  MINT-17110;  MINT-56616;  MINT-56617;  MINT-56618;  MINT-56619;  MINT-56621;  MINT-56626;  MINT-6550679;  MINT-6550697;  MINT-6550709;  MINT-6550722;  MINT-6550731;  MINT-6550741;  MINT-6550759;  MINT-6550777;  MINT-6550791;  MINT-6603869;  MINT-7026649;  MINT-7026658;  MINT-8048571;  MINT-8048594;  MINT-8048620; 
HPRD 00138;  00207;  00616;  00950;  01842;  01867;  03047;  03690;  04668;  05572;  06121;  06159;  07315;  09038;  10440;  12004;  13173;  13853;  14647;  17822; 
IntAct EBI-707234;  EBI-706526;  EBI-707195;  EBI-706513;  EBI-372028;  EBI-2321764;  EBI-372023;  EBI-2515634;  EBI-2337046;  EBI-372011;  EBI-368090;  EBI-372004;  EBI-5241273;  EBI-5241252;  EBI-5241230;  EBI-5241217;  EBI-4370616;  EBI-706506;  EBI-5241242;  EBI-5241265;  EBI-706461;  EBI-5260058;  EBI-706488;  EBI-706437;  EBI-706420;  EBI-706482;  EBI-706633;  EBI-706726;  EBI-706570;  EBI-707161;  EBI-706549;  EBI-707182;  EBI-706533;  EBI-706714;  EBI-706680;  EBI-706668;  EBI-706703;  EBI-706693;  EBI-707130;  EBI-706864;  EBI-706961;  EBI-706884;  EBI-706740;  EBI-706943;  EBI-706923;  EBI-706931;  EBI-706989;  EBI-707108;  EBI-706971;  EBI-707096;  EBI-707088;  EBI-707007;  EBI-707457;  EBI-707448;  EBI-707245;  EBI-707517;  EBI-707478;  EBI-707473;  EBI-707657;  EBI-711124;  EBI-708467;  EBI-708264;  EBI-707699;  EBI-707684;  EBI-707691;  EBI-708448;  EBI-708337;  EBI-708277;  EBI-708308;  EBI-708435;  EBI-708394;  EBI-708423;  EBI-711136;  EBI-711129; 
Database links RefSeq NM_014699
Ensembl ENST00000300850ENST00000394979ENST00000428260ENST00000439353
Entrez Gene Entrez Gene ID:9726
KEGG GENES KEGG GENES(9726)
GeneCard GeneCardZNF646*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Putative Zinc finger, C2H2-type (IPR007087). Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function zinc ion binding (GO:0008270);  nucleic acid binding (GO:0003676); 
Cellular component intracellular (GO:0005622); 

Subcellular localization information  Last modified:20-Apr-2012
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:20-Apr-2012
Start End PDB_ID E-value Identity Coverage SCOP_ID
10 97 1k2fA 3e-07 6.7 76/190 b.8.1.2
236 320 1ny8A 9e-11 4.7 84/97 d.52.6.1
281 408 1qk9A 3e-05 7.0 76/92 d.10.1.3
379 424 1yuiA 5e-04 17.0 46/54 g.37.1.1
463 521 1k2fA 4e-06 8.2 59/190 b.8.1.2
575 656 1qk9A 5e-05 8.5 68/92 d.10.1.3
821 900 1rhyA2 2e-04 8.1 75/94 d.14.1.9
1050 1088 2eppA1 2e-05 19.5 38/53 g.37.1.1
1200 1350 1fs7A 4e-15 13.0 138/471 a.138.1.3
1533 1613 1k2fA 2e-06 6.0 81/190 b.8.1.2
1673 1772 2czrA1 8e-10 8.0 100/218 c.52.4.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:20-Apr-2012
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA151210; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 NA
HG-U133A NA
HG-U133A_2 NA
HG-U133B NA
HG-U133_Plus_2 NA
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3490997;  3491001;  3515298;  3656806;  3656807;  3656808;  3656809;  3656810;  3656811;  3656812;  3656813;  3656814;  3656815;  3656816;  3656817;  3656818;  3656819;  3656820; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:20-Apr-2012
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  156850605013605021606668607339608558608903610260
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(9726)
Disease Entrez Gene ID:(9726)
Substance Entrez Gene ID:(9726)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
11 .. 11 C/T rs55874500 + 5'UTR
92 .. 92 C/G rs75489496 + 5'UTR
107 .. 107 T/C rs3751853 + 5'UTR
716 .. 716 C/T rs28407985 + CDS Nonsynonymous[Ala98Val]
996 .. 996 T/A rs111604081 + CDS Synonymous[Thr191Thr]
1125 .. 1125 G/A rs749671 - CDS Synonymous[Glu234Glu]
1403 .. 1403 A/G rs749670 - CDS Nonsynonymous[Glu327Gly]
1516 .. 1516 G/A rs77579502 + CDS Nonsynonymous[Asp365Asn]
1996 .. 1996 G/A rs112578158 + CDS Nonsynonymous[Gly525Arg]
2119 .. 2119 A/G rs35041466 - CDS Nonsynonymous[Thr566Ala]
2195 .. 2195 A/T rs113882348 + CDS Nonsynonymous[Glu591Val]
2310 .. 2310 A/T rs72785532 + CDS Synonymous[Ser629Ser]
2429 .. 2429 G/A rs75918054 + CDS Nonsynonymous[Arg669Gln]
2745 .. 2745 C/G rs17641067 + CDS Nonsynonymous[Ile774Met]
2872 .. 2872 G/C rs78522165 + CDS Nonsynonymous[Ala817Pro]
3047 .. 3047 C/T rs75586809 + CDS Nonsynonymous[Ala875Val]
3048 .. 3048 G/A rs77095523 + CDS Synonymous[Ala875Ala]
3185 .. 3185 G/C rs35713203 - CDS Nonsynonymous[Gly921Ala]
3219 .. 3219 A/C rs34223943 - CDS Synonymous[Pro932Pro]
3230 .. 3230 C/T rs28735175 + CDS Nonsynonymous[Ser936Leu]
3423 .. 3423 G/C rs117702332 + CDS Nonsynonymous[Met1000Ile]
3854 .. 3854 C/T rs113926102 + CDS Nonsynonymous[Pro1144Leu]
3951 .. 3951 T/C rs75521363 + CDS Synonymous[Thr1176Thr]
3987 .. 3987 T/A/C rs3751855 + CDS
4092 .. 4092 G/A rs62057086 + CDS Synonymous[Gln1223Gln]
4168 .. 4168 C/T rs35376811 - CDS Nonsynonymous[Arg1249Trp]
4376 .. 4376 G/A rs3751856 + CDS Nonsynonymous[Arg1318Gln]
4535 .. 4535 G/A rs77439178 + CDS Nonsynonymous[Arg1371His]
4671 .. 4671 A/G rs117506794 + CDS Synonymous[Leu1416Leu]
4763 .. 4763 C/A rs75083396 + CDS Nonsynonymous[Ala1447Glu]
4789 .. 4789 T/G rs114072963 + CDS Nonsynonymous[Ser1456Ala]
4806 .. 4806 G/A rs36052073 - CDS Synonymous[Lys1461Lys]
4853 .. 4853 G/A rs7196726 + CDS Nonsynonymous[Gly1477Asp]
5211 .. 5211 C/A rs61729520 + CDS Synonymous[Ser1596Ser]
5314 .. 5314 G/A rs79791004 + CDS Nonsynonymous[Asp1631Asn]
5423 .. 5423 C/A rs80281572 + CDS Nonsynonymous[Ser1667Tyr]
5721 .. 5721 T/C rs116190456 + CDS Synonymous[Cys1766Cys]
5786 .. 5786 C/T rs34259949 - CDS Nonsynonymous[Thr1788Met]
5850 ^ 5851 -/G rs35715982 - CDS
6041 .. 6041 G/A rs117819187 + 3'UTR
6296 .. 6296 G/A rs77478478 + 3'UTR
6456 .. 6456 C/A rs78066951 + 3'UTR
6670 .. 6670 G/A rs889550 + 3'UTR
6732 .. 6732 C/T rs750952 + 3'UTR
6867 .. 6867 T/C rs750953 + 3'UTR
7092 .. 7092 G/A rs114426073 + 3'UTR
7305 .. 7305 T/C rs2077633 - 3'UTR
7370 ^ 7371 -/C rs34896559 - 3'UTR
7429 .. 7429 G/A rs2007636 - 3'UTR
7457 .. 7457 T/C rs72785535 + 3'UTR
7525 .. 7525 A/T rs3180955 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer