Alignment of orthologs
Amino acid abbreviation [ Alignment of gene family/group ]

[View by Jalview] (requires Java)

HIT000255549_Homo.            1 MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK 60
XM_001147672_Pan.               MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK
ENSMMUT00000032731_Macaca.      MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK
BC063261_Mus.                   MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK
ENSRNOT00000043895_Rattus.      MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK
ENSCAFT00000010875_Canis.       MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK
XM_001492679_Equus.             MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK
XM_865331_Bos.                  MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK
ENSMODT00000010746_Monodelphis. MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK
NM_001123257_Danio.             MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTKMGDRSQRTK
ENSORLT00000015379_Oryzias.     MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTKMGDKAQRTR
GSTENT00007268001_Tetraodon.    MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTKMGDKAQRTK
SINFRUT00000181802_Takifugu.    MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGSKMGDKAQRTK
                                *************************************************::***::***:

HIT000255549_Homo.           61 PQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI 120
XM_001147672_Pan.               PQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI
ENSMMUT00000032731_Macaca.      PQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI
BC063261_Mus.                   PQMQEERRAKRRKRDEDRHDMNKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI
ENSRNOT00000043895_Rattus.      PQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI
ENSCAFT00000010875_Canis.       PQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI
XM_001492679_Equus.             PQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI
XM_865331_Bos.                  PQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI
ENSMODT00000010746_Monodelphis. PQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI
NM_001123257_Danio.             PQMLEERRAKRRKRDEDRHDINKMKGFTLLSEGIDEMVGIVYKPKTKETRETYEILLSFI
ENSORLT00000015379_Oryzias.     PQNLEDRRNKRRKRDEDRHDINKMKGFTLLSEGIDEMVGIVYKPKTKETRETYEVLLSFI
GSTENT00007268001_Tetraodon.    PQKLEERRDKRRKRDEDRHDINKMKGFTLLSEGIDDMVGIVYKPKTKETRETYEVLLSFI
SINFRUT00000181802_Takifugu.    PQKLEERRDKRRKRDEDRHDINKMKGFTLLSEGIDDMVGIVYKPKTKETRETYEVLLSFI
                                **  *:** ***********:*****:********:****:*************:*****

HIT000255549_Homo.          121 QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKIT 180
XM_001147672_Pan.               QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKIT
ENSMMUT00000032731_Macaca.      QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKIT
BC063261_Mus.                   QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRREIDLLLGQTDDTRYHVLVNLGKKIT
ENSRNOT00000043895_Rattus.      QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRREIDLLLGQTDDTRYHVLVNLGKKIT
ENSCAFT00000010875_Canis.       QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKIT
XM_001492679_Equus.             QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKIT
XM_865331_Bos.                  QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKIT
ENSMODT00000010746_Monodelphis. QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKIT
NM_001123257_Danio.             QAALGDQPRDILCGAADEVLAVLKNDKMRDKERRREVEQLLGPTDDTRYHVLVNLGKKIS
ENSORLT00000015379_Oryzias.     HAALGDQPRDILCGAADEVLAVLKNDKIRDKERRREVEQLLGPSDDTRYHVLVNLGKKIT
GSTENT00007268001_Tetraodon.    HAALGDQVR---------------------------------------------------
SINFRUT00000181802_Takifugu.    HAALGDQPRDILCGAADEVLAVLKNDKMRDKERRREVEQLLGPADDTRYHVLVNLGKKIT
                                :****** *                                                   

HIT000255549_Homo.          181 DYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL 240
XM_001147672_Pan.               DYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
ENSMMUT00000032731_Macaca.      DYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
BC063261_Mus.                   DYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
ENSRNOT00000043895_Rattus.      DYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
ENSCAFT00000010875_Canis.       DYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
XM_001492679_Equus.             DYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
XM_865331_Bos.                  DYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
ENSMODT00000010746_Monodelphis. DYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
NM_001123257_Danio.             DYGGDKELQNMDDNIDETYGVNVQFESDEEEGDEDQYGEVRDEGSD-DSEGEEADESSTL
ENSORLT00000015379_Oryzias.     DYGGDKELQNMDDNIDDTYGVNVQFESDEEEGDENPFGEVQDEQSDEDSEGEEAVVTTTL
GSTENT00007268001_Tetraodon.    -----KFFSSFYDNIDETYGVNVQFESDEEEGDEDLFGEVRDKHSDEDSEGEEANVGCTL
SINFRUT00000181802_Takifugu.    DYGGDKDLQNMDDNIDETYGVNVQFESDEEEGDEDLFGEVRDKHSDEDSEGEEANVGCTL
                                     * :..: ****:*****************: :***::: ** * **:**    **

HIT000255549_Homo.          241 SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR 300
XM_001147672_Pan.               SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
ENSMMUT00000032731_Macaca.      SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
BC063261_Mus.                   SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
ENSRNOT00000043895_Rattus.      SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
ENSCAFT00000010875_Canis.       SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
XM_001492679_Equus.             SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
XM_865331_Bos.                  SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
ENSMODT00000010746_Monodelphis. SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
NM_001123257_Danio.             TANLGNTGDVMMTKKKDLHPRDIDAFWLQRQLSRFYNDAIVSQKKADEVLEILKTASDDR
ENSORLT00000015379_Oryzias.     SANLGETGDVMTVKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
GSTENT00007268001_Tetraodon.    TANLGVTGDVMTVKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTTSDDR
SINFRUT00000181802_Takifugu.    TANLGVTGDVMTVKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTTSDDR
                                :***  :*::*  ***********************:******************:****

HIT000255549_Homo.          301 ECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFL 360
XM_001147672_Pan.               ECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFL
ENSMMUT00000032731_Macaca.      ECENQLVLLLGFNTFDFIKVLRQHRMMSEYMVGSSCRVSTYVKYMVFTKIEKGQEPVILM
BC063261_Mus.                   ECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEPEKERIVGKMEADPELSKFL
ENSRNOT00000043895_Rattus.      ECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFL
ENSCAFT00000010875_Canis.       ECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFL
XM_001492679_Equus.             ECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEPEKERIMGKMEADPELSKFL
XM_865331_Bos.                  ECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFL
ENSMODT00000010746_Monodelphis. ECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMESDPELSKFL
NM_001123257_Danio.             ECENQLVLLLGFNTFDFIKVLRQHRRMILYCTMLASAQSEAEKEKIINKMEADQDLSKVL
ENSORLT00000015379_Oryzias.     ECENQLVLLLGFNTFDFIKILRQHRRMIQYCTMLASAQSEAEKERIIGKMESDPELSKIL
GSTENT00007268001_Tetraodon.    ECENQLVLLLGFNNFDFIKILRQHRRMIQYCTMLASAQSEAEKERIIGKMESDPELSKIL
SINFRUT00000181802_Takifugu.    ECENQLVLLLGFNNFDFIKILRQHRRMIQYCTMLASAQSEAEKERITGKMESDPELSKIL
                                *************.*****:***** *  * .  :.  *   *  :  *:* . :   .:

HIT000255549_Homo.          361 YQLHETEKEDLIREER--SRRERVR--QSRMDTDLETMDL-DQGGEALAPRQVLDLEDLV 415
XM_001147672_Pan.               YQLHETEKEDLIREER--SRRERVR--QSRMDTDLETMDL-DQGGEALAPRQVLDLEDLV
ENSMMUT00000032731_Macaca.      NCFCDFHLRPL-QEER--SRRERVR--QSRMDTDLETMDL-DQGGEALAPRQVLDLEDLV
BC063261_Mus.                   YQLHETEKEDLIREER--SRRERVR--QSRMDTDLETMDL-DQGGEALAPRQVLDLEDLV
ENSRNOT00000043895_Rattus.      YQLHETEKEDLIREER--SRRERVR--QSRMDTDLETMDL-DQGGEALAPRQVLDLEDLV
ENSCAFT00000010875_Canis.       YQLHETEKEDLIREER--SRRERVR--QSRMDTDLETMDL-DQGGEALAPRQVLDLEDLV
XM_001492679_Equus.             YQLHETEKEDLIREER--SRRERVR--QSRMDTDLETMDL-DQGGEALAPRQVLDLEDLV
XM_865331_Bos.                  YQLHETEKEDLIREER--SRRERVR--QSRMDTDLETMDL-DQGGEALAPRQVLDLEDLV
ENSMODT00000010746_Monodelphis. YQLHETEKEDLIREER--SRRERVR--QSRMDTDLETMDL-DQGGEVLAPRQVLDLEDLV
NM_001123257_Danio.             YQLQETEKEDIIREER--SRRERMR--KSRVD-DLESMDI-DH-GESVSSRQLLDLEDLT
ENSORLT00000015379_Oryzias.     YKLQETEKEDIIREEQ--SRRERVR--KSRVD-DLEAMDT-DHGEQSVMPRQILDLEDLT
GSTENT00007268001_Tetraodon.    YQLQETEKEDIIREER--SRRERVR--KSRVD-DLEAMDV-D--SWRVAPRQLLDLDDLA
SINFRUT00000181802_Takifugu.    YQLQETEKEDIIRVSACVSVYQKIKGVANRVL-MLASLRCFPPLSQAVAPRQLLDLDDLA
                                  : : . . : : .   *  ::::   .*:   * ::         : .**:***:**.

HIT000255549_Homo.          416 FTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGF 475
XM_001147672_Pan.               FTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGF
ENSMMUT00000032731_Macaca.      FTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGF
BC063261_Mus.                   FTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGF
ENSRNOT00000043895_Rattus.      FTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGF
ENSCAFT00000010875_Canis.       FTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGF
XM_001492679_Equus.             FTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGF
XM_865331_Bos.                  FTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGF
ENSMODT00000010746_Monodelphis. FTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGF
NM_001123257_Danio.             FTQGSHFMANKRCQLPDGSFRKQRKGYEEVHVPALKPKPFGDEETLVGIEKLPKYAQAGF
ENSORLT00000015379_Oryzias.     FTQGSHFMANKRCQLPDGSFRKQRKGYEEVHVPALKPKAFADNEVLVSIDKLPKYAQAGF
GSTENT00007268001_Tetraodon.    FTQGSHFMANKRCQLPDGSFRKQRKGYEEVHVPALKAKPFAENEALVAIDKLPKYAQAAF
SINFRUT00000181802_Takifugu.    FTQGSHFMANKRCQLPDGSFRKQRKGYEEVHVPALKAKPFAENEVLVGIDKLPKYAQAAF
                                *********************:**************.*.*..:* *: ::********.*

HIT000255549_Homo.          476 EGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDD 535
XM_001147672_Pan.               EGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDD
ENSMMUT00000032731_Macaca.      EGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDD
BC063261_Mus.                   EGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDD
ENSRNOT00000043895_Rattus.      EGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDD
ENSCAFT00000010875_Canis.       EGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDD
XM_001492679_Equus.             EGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDD
XM_865331_Bos.                  EGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDD
ENSMODT00000010746_Monodelphis. EGFKTLNRIQSKLHYAALETDDNLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDD
NM_001123257_Danio.             EGFKSLNRIQSKLFKTTMETDENLLVCAPTGAGKTNVALMAMLREIGKHINMDGTINVAD
ENSORLT00000015379_Oryzias.     EGFKTLNRIQSKLFKSAMDTDENLLVCAPTGAGKTNVALMAMLREIGKHINMDGTINVDD
GSTENT00007268001_Tetraodon.    EGFKTLNRIQSKLFKTSMDTDENLLICAPTGAGKTNVALMAMLREIGKHINMDGTINVDD
SINFRUT00000181802_Takifugu.    EGFKTLNRIQSKLFKTTMETDENLLICAPTGAGKTNVALMAMLREIGKHINMDGTINIDD
                                ****:********. ::::**:***:**************.****************: *

HIT000255549_Homo.          536 FKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDI 595
XM_001147672_Pan.               FKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDI
ENSMMUT00000032731_Macaca.      FKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDI
BC063261_Mus.                   FKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDI
ENSRNOT00000043895_Rattus.      FKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDI
ENSCAFT00000010875_Canis.       FKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDI
XM_001492679_Equus.             FKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDI
XM_865331_Bos.                  FKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDI
ENSMODT00000010746_Monodelphis. FKIIYIAPMRSLVQEMVGNFGKRLATYGINVAELTGDHQLCKEEINATQIIVCTPEKWDI
NM_001123257_Danio.             FKIIYIAPMRSLVQEMVGSFGKRLASYGIIVSELTGDHQLCKEEINATQIIVCTPEKWDI
ENSORLT00000015379_Oryzias.     FKIIYIAPMRSLVQEMVGSFSKRLASYGITVSELTGDHQLCKEEINATQIIVCTPEKWDI
GSTENT00007268001_Tetraodon.    FKIIYIAPMRSLAQEMVG------------LSELTGDHQLCKEEINATQIIVCTPEKWDI
SINFRUT00000181802_Takifugu.    FKIIYIAPMRSLVQEMVGSFSKRLASYGITVSELTGDHQLCKEEINATQIIVCTPEKWDI
                                ************.*****            ::*************.**************

HIT000255549_Homo.          596 ITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATL 655
XM_001147672_Pan.               ITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATL
ENSMMUT00000032731_Macaca.      ITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATL
BC063261_Mus.                   ITRKGGERTYTQLVRLIVLDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATL
ENSRNOT00000043895_Rattus.      ITRKGGERTYTQLVRLIVLDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATL
ENSCAFT00000010875_Canis.       ITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATL
XM_001492679_Equus.             ITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATL
XM_865331_Bos.                  ITRKGGERTYTQLVRLVILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATL
ENSMODT00000010746_Monodelphis. ITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEQVRLIGLSATL
NM_001123257_Danio.             ITRKGGERTYTQLVRLIIIDEIHLLHDDRGPVLESLIARTIRNVELTQEDVRLIGLSATL
ENSORLT00000015379_Oryzias.     ITRKGGERTYTQLVRLIIIDEIHLLHDDRGPVLESLIARTIRNVELTQDDVRLLGLSATL
GSTENT00007268001_Tetraodon.    ITRKGGERTYTQLVRLIIIDEIHLLHDDRGPVLESLVARTIRNVELTQEDVRLLGLSATL
SINFRUT00000181802_Takifugu.    ITRKGGERTYTQLVRLIIIDEIHLLHDDRGPVLESLVARTIRNVELTQEDVRLLGLSATL
                                ****************:::***************:*:**:***:*:**::***:******

HIT000255549_Homo.          656 PNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEH 715
XM_001147672_Pan.               PNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEH
ENSMMUT00000032731_Macaca.      PNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEH
BC063261_Mus.                   PNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEH
ENSRNOT00000043895_Rattus.      PNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEH
ENSCAFT00000010875_Canis.       PNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEH
XM_001492679_Equus.             PNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEH
XM_865331_Bos.                  PNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEH
ENSMODT00000010746_Monodelphis. PNYEDVATFLRVEPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEH
NM_001123257_Danio.             PNYEDVATCLRVDPSKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEH
ENSORLT00000015379_Oryzias.     PNYEDVATCLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEH
GSTENT00007268001_Tetraodon.    PNYEDVATCLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEH
SINFRUT00000181802_Takifugu.    PNYEDVATCLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEH
                                ******** ***:*:*********************************************

HIT000255549_Homo.          716 AGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELK 775
XM_001147672_Pan.               AGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELK
ENSMMUT00000032731_Macaca.      AGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELK
BC063261_Mus.                   AGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELK
ENSRNOT00000043895_Rattus.      AGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELK
ENSCAFT00000010875_Canis.       AGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELK
XM_001492679_Equus.             AGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELK
XM_865331_Bos.                  AGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELK
ENSMODT00000010746_Monodelphis. AGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELK
NM_001123257_Danio.             AGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELK
ENSORLT00000015379_Oryzias.     AGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELK
GSTENT00007268001_Tetraodon.    AGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELK
SINFRUT00000181802_Takifugu.    AGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELK
                                ************************************************************

HIT000255549_Homo.          776 DLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYS 835
XM_001147672_Pan.               DLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYS
ENSMMUT00000032731_Macaca.      DLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYS
BC063261_Mus.                   DLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYS
ENSRNOT00000043895_Rattus.      DLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYS
ENSCAFT00000010875_Canis.       DLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYS
XM_001492679_Equus.             DLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYS
XM_865331_Bos.                  DLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYS
ENSMODT00000010746_Monodelphis. DLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYS
NM_001123257_Danio.             DLLPYGFAIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYS
ENSORLT00000015379_Oryzias.     DLLPYGFAIHHAGMTRVDRTLVEDLFSDRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYS
GSTENT00007268001_Tetraodon.    DLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYS
SINFRUT00000181802_Takifugu.    DLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYS
                                **************************:*:*******************************

HIT000255549_Homo.          836 PEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVS 895
XM_001147672_Pan.               PEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVS
ENSMMUT00000032731_Macaca.      PEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVS
BC063261_Mus.                   PEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVS
ENSRNOT00000043895_Rattus.      PEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVS
ENSCAFT00000010875_Canis.       PEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVS
XM_001492679_Equus.             PEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVS
XM_865331_Bos.                  PEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVS
ENSMODT00000010746_Monodelphis. PEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVS
NM_001123257_Danio.             PEKGRWTELGALDILQMLGRAGRPQYDSKGEGILITSHGELQYYLSLLNQQLPIESQMVG
ENSORLT00000015379_Oryzias.     PEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVA
GSTENT00007268001_Tetraodon.    PEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHAELQYYLSLLNQQLPIESQMVS
SINFRUT00000181802_Takifugu.    PEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHAELQYYLSLLNQQLPIESQMVS
                                ***************************:**********.********************.

HIT000255549_Homo.          896 KLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLD 955
XM_001147672_Pan.               KLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLD
ENSMMUT00000032731_Macaca.      KLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLD
BC063261_Mus.                   KLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLD
ENSRNOT00000043895_Rattus.      KLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLD
ENSCAFT00000010875_Canis.       KLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLD
XM_001492679_Equus.             KLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLD
XM_865331_Bos.                  KLPDMLNAEVVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLD
ENSMODT00000010746_Monodelphis. KLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKSDPLLDQRRLD
NM_001123257_Danio.             KLADMLNAEIVLGNVQNAKDAVNWLGYTYLYVRMLRNPTLYGVSHDDRSIDPLLERRRMD
ENSORLT00000015379_Oryzias.     KLPDMLNAEIVLGNVQTVKDAVNWLGYTYLYVRMLRNPTLYGISQDDRSADPLLERRRMD
GSTENT00007268001_Tetraodon.    KLPDMLNAEIVLGNVQNSK-----------------------------------------
SINFRUT00000181802_Takifugu.    KLPDMLNAEVVLGNVQNAKDAVNWLGYTYLYVRMLRNPTLYAVSHDDRSSDPLLERRRLD
                                **.******:******. *                                         

HIT000255549_Homo.          956 LVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELF 1015
XM_001147672_Pan.               LVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELF
ENSMMUT00000032731_Macaca.      LVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELF
BC063261_Mus.                   LVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELF
ENSRNOT00000043895_Rattus.      LVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELF
ENSCAFT00000010875_Canis.       LVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELF
XM_001492679_Equus.             LVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELF
XM_865331_Bos.                  LVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELF
ENSMODT00000010746_Monodelphis. LVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELF
NM_001123257_Danio.             LVHTAATVLEKNNLVKYDKRSGSFQVTDLGRIASHFYITHESIMTYNQLLKPTLSEIELF
ENSORLT00000015379_Oryzias.     LIHTAANVLDKNSLVKYDKRTGAFQVTDLGRIASHFYITHDSVQTYNQLLKPTLSEIELF
GSTENT00007268001_Tetraodon.    -------------------------VTDLGRIASHFYVTHDSIQTYNQLLKPTLSEIELF
SINFRUT00000181802_Takifugu.    LVHTASSVLDKNNLIKYDKRTGSFQVTDLGRIASHFYVTHDSIQTYNQLLKPTLSEIELF
                                                         **:*******:*:*:::: ****************

HIT000255549_Homo.         1016 RVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGF 1075
XM_001147672_Pan.               RVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGF
ENSMMUT00000032731_Macaca.      RVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGF
BC063261_Mus.                   RVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGF
ENSRNOT00000043895_Rattus.      RVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGF
ENSCAFT00000010875_Canis.       RVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGF
XM_001492679_Equus.             RVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGF
XM_865331_Bos.                  RVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGF
ENSMODT00000010746_Monodelphis. RVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGF
NM_001123257_Danio.             RVFSLSSEFRNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAYISQLKLEGF
ENSORLT00000015379_Oryzias.     RVFSLSSEFKNINVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGF
GSTENT00007268001_Tetraodon.    RVFSLSSEFRNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAYISQLKLEGF
SINFRUT00000181802_Takifugu.    RVFSLSSEFRNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAYISQLKLEGF
                                *********:**.*************************************:*********

HIT000255549_Homo.         1076 ALMADMVYVTQLAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKL 1135
XM_001147672_Pan.               ALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKL
ENSMMUT00000032731_Macaca.      ALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKL
BC063261_Mus.                   ALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKL
ENSRNOT00000043895_Rattus.      ALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKL
ENSCAFT00000010875_Canis.       ALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLPQFLRL
XM_001492679_Equus.             ALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKL
XM_865331_Bos.                  ALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKL
ENSMODT00000010746_Monodelphis. ALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKL
NM_001123257_Danio.             ALMADMVYVTQSAGRLMRAIFEIVLSRGWAQLTDKTLNLCKMIDKRMWQSMSPLRQFRKL
ENSORLT00000015379_Oryzias.     ALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTMNLCKMIDKRMWQSMSPLRQFKKL
GSTENT00007268001_Tetraodon.    ALMADMVYVTQSAGRLMRAIFEIVLSRGWAQLTDKTMNLCKMIDKRMWQSMSPLRQFKKL
SINFRUT00000181802_Takifugu.    ALMADMVYVTQSAGRLMRAIFEIVLSRGWAQLTDKTMNLCKMIDKRMWQSMSPLRQFKKL
                                *********** *************.**********:**************.** ** :*

HIT000255549_Homo.         1136 PEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITR 1195
XM_001147672_Pan.               PEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITR
ENSMMUT00000032731_Macaca.      PEEVVKKIEKKNFPFERLYDLNHNEIGVLFRMPK-GKTIHKYVHLFPKLELSVHLQPITR
BC063261_Mus.                   PEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITR
ENSRNOT00000043895_Rattus.      PEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITR
ENSCAFT00000010875_Canis.       PEEVVNKIEIRHLPFERLYDLNHNELWELIRMPKMGKTIHKYVHLFPKLELSVHLQPITR
XM_001492679_Equus.             PEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITR
XM_865331_Bos.                  PEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITR
ENSMODT00000010746_Monodelphis. PEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITR
NM_001123257_Danio.             PEEVIKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHQFPKLDLAVHLQPITR
ENSORLT00000015379_Oryzias.     PEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHQFPRLDLAVHLQPITR
GSTENT00007268001_Tetraodon.    PEEVIKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHQFPKLDLAVHLQPITR
SINFRUT00000181802_Takifugu.    PEEVIKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHQFPKLDLAVHLQPITR
                                ****::*** :::************:  *:**** ********* **:*:*:********

HIT000255549_Homo.         1196 STLKVELTITPDFQWDEK---VHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLI 1252
XM_001147672_Pan.               STLKVELTITPDFQWDEK---VHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLI
ENSMMUT00000032731_Macaca.      STLKVELTITPDFQWDEK---VHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLI
BC063261_Mus.                   STLKVELTITPDFQWDEK---VHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLI
ENSRNOT00000043895_Rattus.      STLKVELTITPDFQWDEKARLVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLI
ENSCAFT00000010875_Canis.       STLKVELTITPDFQWDEK---VHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLI
XM_001492679_Equus.             STLKVELTITPDFQWDEK---VHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLI
XM_865331_Bos.                  STLKVELTITPDFQWDEK---VHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLI
ENSMODT00000010746_Monodelphis. STLKVELTITPDFQWDEK---VHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLI
NM_001123257_Danio.             STLKVELTITPDFQWDDK---IHGSSEAFWILVEDVDSEVVLHHEYFLLKAKYAQDEHLV
ENSORLT00000015379_Oryzias.     STLKVELTITPDFQWDDK---IHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLV
GSTENT00007268001_Tetraodon.    STLKVELTITPDFQWDDK---IHGSSEAFWILVEDVD-----------------------
SINFRUT00000181802_Takifugu.    STLKVELTITPDFQWDDK---IHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLV
                                ****************:*   :***************                       

HIT000255549_Homo.         1253 TFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSAL 1312
XM_001147672_Pan.               TFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSAL
ENSMMUT00000032731_Macaca.      TFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSAL
BC063261_Mus.                   TFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSAL
ENSRNOT00000043895_Rattus.      TFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSAL
ENSCAFT00000010875_Canis.       TFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSAL
XM_001492679_Equus.             TFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSAL
XM_865331_Bos.                  TFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSAL
ENSMODT00000010746_Monodelphis. TFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSAL
NM_001123257_Danio.             TFFVPVFEPLPPQYFIRIASDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSAL
ENSORLT00000015379_Oryzias.     TFFVPVFEPLPPQYFIRMVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVTAL
GSTENT00007268001_Tetraodon.    ----------------------------------------KKYPPPTELLDLQPLPVTAL
SINFRUT00000181802_Takifugu.    TFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVTAL
                                                                        :****************:**

HIT000255549_Homo.         1313 RNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSS 1372
XM_001147672_Pan.               RNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSS
ENSMMUT00000032731_Macaca.      RNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSS
BC063261_Mus.                   RNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQNS
ENSRNOT00000043895_Rattus.      RNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQNS
ENSCAFT00000010875_Canis.       RNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQNS
XM_001492679_Equus.             RNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQNS
XM_865331_Bos.                  RNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQNS
ENSMODT00000010746_Monodelphis. RNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQNS
NM_001123257_Danio.             RNGAFESLYQN-FPFFNPIQTQVFNAVYNSDDNVFVGAPTGSGKTICAEFAILRMLLHNA
ENSORLT00000015379_Oryzias.     RNSAFEALYQNKFPFFNPIQTQVFNAVYNSDDNVFVGAPTGSGKTICAEFAILRMLLHNT
GSTENT00007268001_Tetraodon.    RNSAFEAVYQNKFPFFNPIQTQVFNAVYNSDDNVFVGAPNGSGKTICAEFAILRMLLHNA
SINFRUT00000181802_Takifugu.    RNSAFEAVYQNKFPFFNPIQTQVFNAVYNSDDNVFVGAPNGSGKTICAEFAILRMLLHNA
                                **.***::**: *************:*************.*****************:.:

HIT000255549_Homo.         1373 EGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKW 1432
XM_001147672_Pan.               EGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKW
ENSMMUT00000032731_Macaca.      EGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKW
BC063261_Mus.                   EGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKW
ENSRNOT00000043895_Rattus.      EGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKW
ENSCAFT00000010875_Canis.       EGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKW
XM_001492679_Equus.             EGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKW
XM_865331_Bos.                  EGRCVYITPMEALAEQVYMDWYEKFQDRLSKKVVLLTGETSTDLKLLGKGSVIVSTPEKW
ENSMODT00000010746_Monodelphis. EGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKW
NM_001123257_Danio.             EGRCVYITPMEALAEQVFLDWHQKFQENLNKKVVLLTGETSTDLKLLGKGDIIVSTPDKW
ENSORLT00000015379_Oryzias.     EGRCVYITPMEALAEQVFVDWHQKFQDILNKKVVLLTGETSTDLKLLGKGDIIISTPDKW
GSTENT00007268001_Tetraodon.    EGRCIYITPMEALAEQVFVDWHQKFQDILNKKVVLLTGETSTDLKLLGK-----------
SINFRUT00000181802_Takifugu.    EGRCIYITPMEALAEQVFVDWHQKFQDILNKKVVLLTGETSTDLKLLGKGDIIVSTPDKW
                                ****:************::**::***: *.*******************           

HIT000255549_Homo.         1433 DILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSS 1492
XM_001147672_Pan.               DILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSS
ENSMMUT00000032731_Macaca.      DILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSS
BC063261_Mus.                   DILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSS
ENSRNOT00000043895_Rattus.      DILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSS
ENSCAFT00000010875_Canis.       DILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSS
XM_001492679_Equus.             DILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSS
XM_865331_Bos.                  DILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSS
ENSMODT00000010746_Monodelphis. DILSRRWKQRKNVQNVNLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSS
NM_001123257_Danio.             DILSRRWKQRKNVQNVSLFIIDEVHLIGGDNGPVLEVICSRMRYISSQIERPIRIVALSS
ENSORLT00000015379_Oryzias.     DILSRRWKQRKNVQNVSLFIVDEAHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSS
GSTENT00007268001_Tetraodon.    ------------------------------------------------------------
SINFRUT00000181802_Takifugu.    DILSRRWKQRKNVQNVSLFIVDEAHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSS
                                                                                            

HIT000255549_Homo.         1493 SLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITK 1552
XM_001147672_Pan.               SLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITK
ENSMMUT00000032731_Macaca.      SLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAVTK
BC063261_Mus.                   SLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITK
ENSRNOT00000043895_Rattus.      SLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITK
ENSCAFT00000010875_Canis.       SLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITK
XM_001492679_Equus.             SLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITK
XM_865331_Bos.                  SLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITK
ENSMODT00000010746_Monodelphis. SLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITK
NM_001123257_Danio.             SLSNAKDVAHWLGCSTTATFNFHPNVRPVPLELHIQGFNVSHTQTRLLSMAKPVYHAIMK
ENSORLT00000015379_Oryzias.     SLSNAKDMAHWLGCSTTATFNFHPNVRPVPLELHIQGFNVSHTQTRLLSMAKPVYHAIMK
GSTENT00007268001_Tetraodon.    ------------------------------------------------------------
SINFRUT00000181802_Takifugu.    SLSNAKDVAHWLGCSTTATFNFHPNVRPVPLELHIQGFNVSHTQTRLLSMAKPVYHAIMK
                                                                                            

HIT000255549_Homo.         1553 HSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKET 1612
XM_001147672_Pan.               HSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKET
ENSMMUT00000032731_Macaca.      HSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKET
BC063261_Mus.                   HSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKET
ENSRNOT00000043895_Rattus.      HSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKET
ENSCAFT00000010875_Canis.       HSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKET
XM_001492679_Equus.             HSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKET
XM_865331_Bos.                  HSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKET
ENSMODT00000010746_Monodelphis. HSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKET
NM_001123257_Danio.             HSPSKPVLVFVPSRRQTRLTAIDILTFCAADVVPQRFLHSTEKDLVPFMENLSDVTLKET
ENSORLT00000015379_Oryzias.     HSPSKPAVVFVPSRRQTRLTAIDILTFCAADVVPQRFLHCTEKDLVPFLEKINDPTLKET
GSTENT00007268001_Tetraodon.    ------------------------------------------------------------
SINFRUT00000181802_Takifugu.    HSPSKPAVVFVPSRRQTRLTAIDILTFCAADVVPQRFLHCTEKDLAPFLEKLNDSTLKET
                                                                                            

HIT000255549_Homo.         1613 LLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGK 1672
XM_001147672_Pan.               LLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGK
ENSMMUT00000032731_Macaca.      LLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGK
BC063261_Mus.                   LLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGK
ENSRNOT00000043895_Rattus.      LLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGK
ENSCAFT00000010875_Canis.       LLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGK
XM_001492679_Equus.             LLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGK
XM_865331_Bos.                  LLNGVGYLHEGLSPLERRLVEQLFSSGAIQVVVASRSLCWGLNVAAHLVIIMDTQYYNGK
ENSMODT00000010746_Monodelphis. LLNGVGYLHEGLSPAERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGK
NM_001123257_Danio.             LSNGVGYLHEGLSPTERRIVEHLFTSGAIQVVVASRSLCWGTNISAHLVIVMDTQYYNGK
ENSORLT00000015379_Oryzias.     LANGVGYLHEGLSATERKIVEQLFNSGAVQVVVSSRSLCWGISISAHLVIVMDTQYYNGK
GSTENT00007268001_Tetraodon.    --------------------------GAVQVVVASRSLCWGISISAHLVIVMDTQYYNGK
SINFRUT00000181802_Takifugu.    LANGVGYLHEGLSATERRIVEQLFNSGAVQVVVASRSLCWGINISAHLVIVMDTQYYNGK
                                                          **:****:******* .::*****:*********

HIT000255549_Homo.         1673 IHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCM 1732
XM_001147672_Pan.               IHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCM
ENSMMUT00000032731_Macaca.      IHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCM
BC063261_Mus.                   IHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCM
ENSRNOT00000043895_Rattus.      IHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCM
ENSCAFT00000010875_Canis.       IHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCM
XM_001492679_Equus.             IHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCM
XM_865331_Bos.                  THAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCM
ENSMODT00000010746_Monodelphis. IHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCM
NM_001123257_Danio.             IHAYVDYPIYDVLQMVGKANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCL
ENSORLT00000015379_Oryzias.     IHAYVDYPIYDVLQMVGKANRPMLDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCL
GSTENT00007268001_Tetraodon.    IHSYVDYPIYDILQMVGRANRPMQDDEGRCVIMCQGSKK---------------------
SINFRUT00000181802_Takifugu.    IHSYVDYPIYDILQMVGRANRPMQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCL
                                 *:********:*****:****: ***************                     

HIT000255549_Homo.         1733 HDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQT 1792
XM_001147672_Pan.               HDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQT
ENSMMUT00000032731_Macaca.      HDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQT
BC063261_Mus.                   HDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQT
ENSRNOT00000043895_Rattus.      HDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQT
ENSCAFT00000010875_Canis.       HDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQT
XM_001492679_Equus.             HDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQT
XM_865331_Bos.                  HDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQT
ENSMODT00000010746_Monodelphis. HDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQT
NM_001123257_Danio.             HDHFNAEIVTKTVENKQDAVDYLTWTFLYRRMTQNPNYYNLQGMSHRHLSDHLSELVENT
ENSORLT00000015379_Oryzias.     HDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGMSHRHLSDHLSELVENT
GSTENT00007268001_Tetraodon.    ------------------------------------------------------------
SINFRUT00000181802_Takifugu.    HDHFNAEIVTKTVENKQDAVDYLTWTFLYRRMTQNPNYYNLQGMSHRHLSDHLSELVETT
                                                                                            

HIT000255549_Homo.         1793 LSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNA 1852
XM_001147672_Pan.               LSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNA
ENSMMUT00000032731_Macaca.      LSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNA
BC063261_Mus.                   LSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNA
ENSRNOT00000043895_Rattus.      LSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNA
ENSCAFT00000010875_Canis.       LSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNA
XM_001492679_Equus.             LSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNA
XM_865331_Bos.                  LSDLEQSKCISVEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNA
ENSMODT00000010746_Monodelphis. LSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNA
NM_001123257_Danio.             LQDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNA
ENSORLT00000015379_Oryzias.     LHDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKIRGLIEIISNA
GSTENT00007268001_Tetraodon.    ------------------------------------------------------------
SINFRUT00000181802_Takifugu.    LHDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKIRGLIEIISNA
                                                                                            

HIT000255549_Homo.         1853 AEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDT 1912
XM_001147672_Pan.               AEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDT
ENSMMUT00000032731_Macaca.      AEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDT
BC063261_Mus.                   AEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDT
ENSRNOT00000043895_Rattus.      AEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDT
ENSCAFT00000010875_Canis.       AEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDT
XM_001492679_Equus.             AEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDT
XM_865331_Bos.                  AEYENIPIRHHEDSLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDT
ENSMODT00000010746_Monodelphis. AEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDT
NM_001123257_Danio.             AEYKNIPIRHHEDTLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDT
ENSORLT00000015379_Oryzias.     AEYKNIPIRHHEDTLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDT
GSTENT00007268001_Tetraodon.    ------------------LAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDT
SINFRUT00000181802_Takifugu.    AEYKNIPIRHHEDTLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDT
                                                  ******************************************

HIT000255549_Homo.         1913 EEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIK 1972
XM_001147672_Pan.               EEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIK
ENSMMUT00000032731_Macaca.      EEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIK
BC063261_Mus.                   EEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIK
ENSRNOT00000043895_Rattus.      EEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIK
ENSCAFT00000010875_Canis.       EEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIK
XM_001492679_Equus.             EEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIK
XM_865331_Bos.                  EEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMATQAMWSKDSYLKQLPHFTSEHIK
ENSMODT00000010746_Monodelphis. EEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSDHIK
NM_001123257_Danio.             EEILSKAVRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLRQLPHFTSELIK
ENSORLT00000015379_Oryzias.     EEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPYFTSEHIK
GSTENT00007268001_Tetraodon.    EEILSKAVRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPFFTSEHIK
SINFRUT00000181802_Takifugu.    EEILSKAVRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPFFTSEHIK
                                *******:****************************.***********:***.***: **

HIT000255549_Homo.         1973 RCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSG 2032
XM_001147672_Pan.               RCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSG
ENSMMUT00000032731_Macaca.      RCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSG
BC063261_Mus.                   RCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSG
ENSRNOT00000043895_Rattus.      RCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSG
ENSCAFT00000010875_Canis.       RCTDKGVESVFDIMEMEDEERNALLQLSDSQIADVARFCNRYPNIELSYEVVDKDSIRSG
XM_001492679_Equus.             RCTDKGVESVFDIMEMEDEERNALLQLSDSQIADVARFCNRYPNIELSYEVVDKDSIRSG
XM_865331_Bos.                  RCTDKGVESVFDIMEMEDEERNALLQLSDSQIADVARFCNRYPNIELSYEVVDKDAIRSG
ENSMODT00000010746_Monodelphis. RCTDKGVESVFDIMEMEDEERNTLLQLSDNQIADVARFCNRYPNIELSYEVVEKESIRSG
NM_001123257_Danio.             RCTDKGVESIFDIMEMEDEDRTGLLQLSDVQVADVARFCNRYPNIELSYEVVDKDDIKSG
ENSORLT00000015379_Oryzias.     RCTDKGVESIFDIMEMEDEDRSGLLQLTDAQMADVARFCNRYPNIELAYEVVERDNIKSG
GSTENT00007268001_Tetraodon.    RCTEKGVESIFDIMEMEDEERTALLQLSDIQMADVARFCNRYPNIELSYEVADRDSIKSG
SINFRUT00000181802_Takifugu.    RCTDKGVESIFDIMEMEDEDRSALLQLSDVQMADVARFCNRYPNIELSYEVAEKDNIKSG
                                ***:*****:*********:*. ****:* *:***************:***.::: *:**

HIT000255549_Homo.         2033 GPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKL 2092
XM_001147672_Pan.               GPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKL
ENSMMUT00000032731_Macaca.      GPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKL
BC063261_Mus.                   GPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKL
ENSRNOT00000043895_Rattus.      GPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKL
ENSCAFT00000010875_Canis.       GPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKL
XM_001492679_Equus.             GPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKL
XM_865331_Bos.                  GPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKL
ENSMODT00000010746_Monodelphis. GPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDSKSNSLISIKRLTLQQKAKVKL
NM_001123257_Danio.             SPVVVQVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDPKSNSLISIKRLTLQQKAKVKL
ENSORLT00000015379_Oryzias.     SPVLVQVQLEREEEVTGPVVAPLFPQKREEGWWVVIGDPKSNSLISIKRLTLQQKAKVKL
GSTENT00007268001_Tetraodon.    SPVLVQVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDPKSNSLISIKRLTLQQKAKVKL
SINFRUT00000181802_Takifugu.    SPVLVQVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDPKSNSLISIKRLTLQQKAKVKL
                                .**:* *************:******************.*********************

HIT000255549_Homo.         2093 DFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD-- 2136
XM_001147672_Pan.               DFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD--
ENSMMUT00000032731_Macaca.      DFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD--
BC063261_Mus.                   DFVAPATGGHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD--
ENSRNOT00000043895_Rattus.      DFVAPATGGHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD--
ENSCAFT00000010875_Canis.       DFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD--
XM_001492679_Equus.             DFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD--
XM_865331_Bos.                  DFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD--
ENSMODT00000010746_Monodelphis. DFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAESDSDSD--
NM_001123257_Danio.             DFVAPVVGVHNYTLYFMSDAYMGCDQEYKFSTEVKEADSEGDSDSD
ENSORLT00000015379_Oryzias.     DFVAPAMGIHNYTLYFMSDAYMGCDQEYKFSVDVKEADSDSDSD--
GSTENT00007268001_Tetraodon.    DFVAPAMGIHNYTLYFMSDAYMGCDQEYKFSVDVKEADSDGDSD--
SINFRUT00000181802_Takifugu.    DFVAPAMGIHNYTLYFMSDAYMGCDQEYKFGVDVKEADSDGDSDSD
                                *****. * *********************..:****:::.***