Alignment of orthologs
Amino acid abbreviation

[View by Jalview] (requires Java)

HIT000245485_Homo.            1 MAVYCYALNSLVIMNSANEMKSGGGPGPSG--SETPPPPRRAV---------------LS 43
XM_001141527_Pan.               MAVYCYALNSLVIMNSANEMKSGGGPGPSG--SETPPPPGRAV---------------LS
ENSPPYT00000000173_Pongo.       MAVYCYALNSLVIMNSANEMKSGGGPGPSG--SETPPPPGRAV---------------LS
XM_001089824_Macaca.            MAVYCYALNSLVIMNSANEVKSGGGPGPSG--SETPPPPGKAV---------------LS
ENSMUST00000070181_Mus.         MAVYCYALNSLVIMNSTNELKS-GGPRPSG--SETPQPSGRAA---------------LS
AJ242781_Rattus.                MAVYCYALNSLVIMNSTNELKS-GSPLPSG--SETPQPSGRAA---------------LS
XM_547504_Canis.                MAVYCYALNSLVIMNSAEQVKS-GGPRPSG--SETPPPPARAV---------------LS
XM_613550_Bos.                  MAMYCYALNSLVIMNSANQVKSGGGPRSSS--NETPPPPGRAV---------------LS
XM_001376990_Monodelphis.       MAVYCYALNSLVMMNSSSNVES-GSGGCSGGSGKAPPPSGRPG----------LSVPVLS
XM_415039_Gallus.               MAVYCYALNSLVIMNSNSEVKS------SG--SKTPPPSRQALPRSPETAGSCCPLPPFS
XM_686383_Danio.                MA--AYALNSLIMMNPNNLTNK-NSPR-TG--RPVLPVPSRST---------------FS
                                **  .******::**. .  :.      :.    .   . :.                :*

HIT000245485_Homo.           44 P-----GSV--FSPG------RGASFLFPPAESLSPEEPRSPGGWRSGRRRLNSSSGSGS 90
XM_001141527_Pan.               P-----GSV--FSPG------RGASFLFPPAESLSPEEPRSPGGWRSGRRRLNSSSGSGS
ENSPPYT00000000173_Pongo.       P-----GSV--FSPR------RGASFLFPPAESLSPEEPRSPGGWRSGRRRLNSSSGSGS
XM_001089824_Macaca.            P-----GSV--FSPG------RGASFLFPPVESLSPEEPRSPGGWRSGRRRLNSSSGSG-
ENSMUST00000070181_Mus.         P-----GSV--FSPG------RGASFLFPPAESLSLEEPGSPGGWRSGRRRLNSSSGSGG
AJ242781_Rattus.                P-----GSV--FSPG------RGASFLFPPAESLSLEEPGSAGGWRSGRRRLNSSSGSGG
XM_547504_Canis.                P-----GSV--FSPG------RGASFLFPPAESSSPEEPGSPGGWRSGRRRLSGGGGGGG
XM_613550_Bos.                  P-----GSV--FSPG------SGSSFLFPPAESLSPEDPGSPPGWRSGRRRLNSSSGSG-
XM_001376990_Monodelphis.       P----DNSV--FSPG------RSTSFLFPPSDRLSPDESGSPGSWRGGGSSSTRSSSSGS
XM_415039_Gallus.               P-----TTVSPRSPR------LSSAFLFPPPEE-PPPQLVSPGGRRGSR-----------
XM_686383_Danio.                PPLGGSGSP--YSPGSLSPGSSGKSFVFPTSTGSSCQRALSP-----CRR----------
                                *      :    **        . :*:**.    .     *.                  

HIT000245485_Homo.           91 GSSG--------SSVSSPSWAGRLRGDRQQVVAAGTLSPPGPEEAKRKLRILQ--RELQN 140
XM_001141527_Pan.               GSSG--------SSVSSPSWAGRLRGDRQQVVAAGTLSPPGPEEAKRKLRILQ--RELQN
ENSPPYT00000000173_Pongo.       GSSG--------SSVSSPSWAGRLRGDGQQVVAAGTLSPPGPEEAKRKLRILQ--RELQN
XM_001089824_Macaca.            --SG--------SSVSSPSWAGRLRGDGQQVVAAGTLSPPGPEEAKRKLRILQ--RELQN
ENSMUST00000070181_Mus.         GSSSSN--SSSSSGVGSPSWAGRLRGDAQQVVAARILSPPGPEEAQRKLRILQ--RELQN
AJ242781_Rattus.                GSSSSN--SSSSSGVGSPSWAGRLRGDAQQVVATRILSPPGPEEAQRKLRILQ--RELQN
XM_547504_Canis.                GGAG---------SLSSPSRAGRPPGDGQQAVTAASLSPPGPEEAQRKLRILQ--RELQN
XM_613550_Bos.                  ------------SSVGSPSWAGRLRGEGQQMVTAGTLSPPGPEEAKRKLRILQ--RELQN
XM_001376990_Monodelphis.       SSSSRRRLNSSSSSVGSPSWAPRLGGEGQQVVSPGSLSPTGPEEAKKKLRILE--WELQN
XM_415039_Gallus.               ----------------------------------GGDRPPGSPAARR----LQ--RELHN
XM_686383_Danio.                ---------PESLGVHVGSRVRRLSGSG--------LEEEQENEERRVALQLERNRELQN
                                                                             ::    *:   **:*

HIT000245485_Homo.          141 VQVNQKVGMFEAHIQAQSSAIQAPRSPRLGRAHSP---SPCPFRSSSQPPGRVLVQGARS 197
XM_001141527_Pan.               VQVNQKVGMFEAHIQAQSSAIQAPRSPRLGRARSP---SPCPFRSSSQPPGRVLVQGARS
ENSPPYT00000000173_Pongo.       VQVNQKVGMFEAHIQAQSSAIQAPRSPRLGRARSP---SPCPFRSSSQPPGRVPVQGARS
XM_001089824_Macaca.            VQVNQKVGMFEAHIQAQSSAIQAPRSPRLGRARSP---SPCPLRSSSQPPGRVLVQGARI
ENSMUST00000070181_Mus.         VQVNQKVGMFEAQIQAQSSAIQAPRSPRLGRARSP---SPCPFRSSSQPPERVLAPCSPS
AJ242781_Rattus.                VQVNQKVGMFEAQIQAQTSAIQAPRSPRLGRARSP---SPCPFRSSSQPPERVLAPCSPS
XM_547504_Canis.                VQVNQKVGLFEAHIQAQSSAALAPRSPRLGRARSP---SPCPLRSSSQPPGRALAQ---S
XM_613550_Bos.                  VQVNQKVGMFEAHIQAQSSATQPPRSPRLGRARSP---SPCPLRSVSQPPGRVLVQ---S
XM_001376990_Monodelphis.       VQVNQKVGMFEAHIQAQSSAREASRSPRLGRARSP---SPCPSRSSSQPPGRILAEYTQI
XM_415039_Gallus.               VQVNQKVGLFEAHIQAHSSGAHSPWSPPPSSPRPS---SPQP-----------------S
XM_686383_Danio.                VGVNKKVDLFEAQISAQAFSREVQRSPRISR-KSPHYFAPVQLTNLSLNPEETLAT----
                                * **:**.:***:*.*:: .     **  .  :..   :*                    

HIT000245485_Homo.          198 EERRTKSW-GEQCSETSGTDSGRKGG-PSLCSSQVKKG-MPPLPGRAAPTGSEAQGPSAF 254
XM_001141527_Pan.               EERRTKSW-GEQCPETSGTDSGRKGG-PSLCPSQVKKG-MPPLPGRAAPTGSEAQGPSAF
ENSPPYT00000000173_Pongo.       EERRTKSW-GEQCPETSGTDSGRKGG-PSLCTSQVKKG-MPPLPGRAAPTGSEAQGPSAF
XM_001089824_Macaca.            EERRTKSW-GEQCPETSGADSRRKGG-PGLCTSQVKEG-MPPLPGRGAPTGSEAWGP--F
ENSMUST00000070181_Mus.         EERRTKSW-GEQCTETPDTNSGRRSR-LSTHPSKDKEG-VAPLLGPASPTRLGTQSPSTS
AJ242781_Rattus.                EERRTKSW-GEQCTETPDANSRRRSR-LSTHPSKDKEG-VAPLLGPASPTRLGTQSPSTS
XM_547504_Canis.                EERRTKSW-GDQCPETSEAGPGRRGRAPGLCLSEGGEG-AAPLPGPAALSEPGARGAAAS
XM_613550_Bos.                  EERRTKSW-GEQCPETSEVESGRRGGSPSVCLSKDKEGVVAPFLRPAAPSGSGAQGPSAS
XM_001376990_Monodelphis.       EERRTKSW-GEQCLETPAERGSKEGQ-----PRESRSS-VSPLETERRALTLGTSRRDTP
XM_415039_Gallus.               SPRPSSSWPSSPRLSSPRPSSPR-------------------------------------
XM_686383_Danio.                ---RNKDH-STGIPKELQNGKRFSGTEEGLQVSGEEKD----------------------
                                    ...  .    .                                             

HIT000245485_Homo.          255 VRMEKGIPASPRCGSP----------------TAMEIDKRGSPTPGTRSCLAPS----LG 294
XM_001141527_Pan.               VRMEKGIPASPCCGSP----------------TAMEIDKRGSPTPGTRSCLAPS----LG
ENSPPYT00000000173_Pongo.       VRMEKGIPASPRCGSP----------------TAMEIDKRGFLTPGTRSCLAPS----LG
XM_001089824_Macaca.            VRMEKGISASPRCDSP----------------TAMEIDKRVSPPPGTRSCLAPS----LG
ENSMUST00000070181_Mus.         VRMERGTPASPRCGSP----------------TPMETDKR----------VAPS----LE
AJ242781_Rattus.                VRMERGSPASPRCGSP----------------TPMEIDKR----------TAPS----LE
XM_547504_Canis.                ARMEKGSPARPHCGSP----------------RLMETDERVSPPSGTRSCPAPP----SG
XM_613550_Bos.                  ERMEKALPAGPHCGSP----------------TAMEVDKRGSPPLGTQNSQAPS----LG
XM_001376990_Monodelphis.       METGNWSLARGPQGSPLGVEMEKGTHTGRATFTNKEVRKGDHPLPGAQGCETLVDSRGVK
XM_415039_Gallus.               -------PSSPRPASP----------------------------------TVPM----MG
XM_686383_Danio.                ------------------------------------------------------------
                                                                                            

HIT000245485_Homo.          295 LFAPSFPMATEVAARVTSTGPHRPQDLALTEPSGRARELEDLQPPEALVERQGQFLG--- 351
XM_001141527_Pan.               LVGASLTMATEVAARVTSTGPHRPQDLALTEPSGRARELEDLQPPEALVERQGQFLG---
ENSPPYT00000000173_Pongo.       LVGASLTVATEVAARATCTGPHRPQDLALTEPSGRARELEDLQPPEALVEKQGQFLG---
XM_001089824_Macaca.            LVGASLTMATEVAARATPTGPHRPQDLALTEPSGRARELEDPQPREALVERQGQFLG---
ENSMUST00000070181_Mus.         RFGTSLTLATKVAASAASAGPHPGHDSALMETGC---ELGGMRPWEAQMERRGQFLG---
AJ242781_Rattus.                HFGTSLTLATKVAASAASAGPHPGHDSVLMEADC---ELGAMRPWEAHLERRGQFLG---
XM_547504_Canis.                LPGVHLAMAAEVAAGATASGPHHAHDPGLPE-----------RPREPPVQSQWQPLG---
XM_613550_Bos.                  LVRVNLTVDTAVAARATSTVPHHPHDPALIEPSEKARELGGAHPLEALAKSQGQFLG---
XM_001376990_Monodelphis.       LSREAGTAGVKEVERRDSTGRE--------------------HPSEALSQETSAWIERGF
XM_415039_Gallus.               L-----------------------------------------------------------
XM_686383_Danio.                ------------------------------------------------------------
                                                                                            

HIT000245485_Homo.          352 ------SETSPAPERGGPRDGEPPG---------------KMGKGYLP------------ 378
XM_001141527_Pan.               ------SETSPAPERGGPRDGEPPG---------------KMGKGNLP------------
ENSPPYT00000000173_Pongo.       ------SETSPAPERGGPRDGEPPG---------------KMGKGNLP------------
XM_001089824_Macaca.            ------SETSPAPERGGPRAGEPPG---------------KMGKGNLP------------
ENSMUST00000070181_Mus.         ------KETGSTPEPVRTHMREPPG---------------RVGRGIHS------------
AJ242781_Rattus.                ------RETGSAPEPIRTHIREPPG---------------RVER-VHS------------
XM_547504_Canis.                ------SATSLAPERGGPLSGEPPG---------------KMGKKDPPGGGGGGGGGGGG
XM_613550_Bos.                  ------SETSPAPERGGPRSGEPPG---------------KVGRGTLS------------
XM_001376990_Monodelphis.       VSFGVCASENPVQREGRTRCSGPPAAQEKVGIGVSKAALEKLEKGNLP------------
XM_415039_Gallus.               -------GTGPRPQACGESKDPDAG-----------------------------------
XM_686383_Danio.                -------GADPNTEEGGPHKSTSAG-----------------------------------
                                         .   .         ..                                   

HIT000245485_Homo.          379 --CGMPGSGEPEVGKRPEETTVSVQS-AESSDSLSWSRLPRALASVGPEEARSGAPVGGG 435
XM_001141527_Pan.               --CGMPGSGAPEVGKRPEETTVSVQS-AESSDALSWSRLPRALASVGPEEARSGAPVGGG
ENSPPYT00000000173_Pongo.       --CGMPGSGAPEVGKRPEETTVSVQS-AESSDALSWSRLPRALASVGPEEARSGTPVGGG
XM_001089824_Macaca.            --CGMPGSGAPEVGERPEETTVSVQS-AESSDALSWSRLPRALASVGPEEARSGAPVGRG
ENSMUST00000070181_Mus.         --VGGQGSWTPEVIKRPEERAVTAQS-SEPSEDPRWSRLPVDLDSVGPEKGGNRIPGMRG
AJ242781_Rattus.                --VGGQGSWTPEVIKRPEEGTVDAQS-SELSENPRWSRLPGDPGSVGPEKGGSRIPGIRG
XM_547504_Canis.                GGGGVRGSEAPEA-RRPEDGTVNAPS--QLSES-RVRPLPDPGSSGGPEVTRGGAPVVGE
XM_613550_Bos.                  --DGMPSSRAPGADGRPEERTGNAQSPAEVPEAPTWFR----QGSRGSAGTQSGALVVRE
XM_001376990_Monodelphis.       --GLLQGSLAPEESEGRNTPALDMQS-SVPSVARSCTR-----ASTGHSLVASGEPQKKG
XM_415039_Gallus.               -----------GAQDRPSVAGLVVME----------------------------------
XM_686383_Danio.                -----------TKSDADSLT--DNHS-RTLSEA---------------------------
                                                 .       .                                  

HIT000245485_Homo.          436 -------RWQLSDRVEGGS----PTLGLLGGSPSAQPGTGNV--EAGIPSGRMLEPLPCW 482
XM_001141527_Pan.               -------RWQLSDRVEGGS----PTLGLLGGSPSAQPGTGNV--EAGIPSGRMLEPLPRW
ENSPPYT00000000173_Pongo.       -------RWQLSDRVEGGS----PTLGLLGGSPSAQPGTGNV--EAGIPSGRMLEPLPCW
XM_001089824_Macaca.            -------RWQLSDRVEGGS----PTLGLLGGSPSAQPGTPDV--EAGIPSGRMLEPLPCW
ENSMUST00000070181_Mus.         -------PQQTLDSEREGS----PALGLLGGSQAAQPGARGV--EEDVHYGRMLEPLPPG
AJ242781_Rattus.                -------PQQTLDSMREGS----SALGLLGGSQAAQPGSMDV--ETGISCGRMLEPLPPG
XM_547504_Canis.                -------PPQHSRGADEGSLTPTTTLGLLGDLRSG-ASTREV--EAGIASGGMLEPLPSW
XM_613550_Bos.                  -------APPASNRVDEGS----ATLGLLGGSSSEQPGTPEV--QAGVPSGGMLEPLPCW
XM_001376990_Monodelphis.       SLVVLVQRPDFDQGEKTGT----KSFGIPGRAVHLGKVEVEVESESGILSGHMQDALPCR
XM_415039_Gallus.               -------------GQAVG-----QAVGT--------------------------------
XM_686383_Danio.                ------------------------------------------------------------
                                                                                            

HIT000245485_Homo.          483 DAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTR-GTGVQSEGT-WESQRQDSD 540
XM_001141527_Pan.               DAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEEAGLAWTR-GTGVQSEGT-WESQRQDSD
ENSPPYT00000000173_Pongo.       DAAKDLKEPQCPPGDRVGVQPGSSRVWQGTMEEAGLAWTR-GTGVQSEGT-WESQRQDSD
XM_001089824_Macaca.            DTAKDLKEPQCPPGDRVGVQPGSSRVWQGTMEEVGLAWTC-GTGVQSEGT-WESQRQDRD
ENSMUST00000070181_Mus.         EVTTKLKEPQCLPGDRMGMQPESSIVWPSALEEAPLIWTR-DTGVQSKGT-WGSQLPDGD
AJ242781_Rattus.                EVTTNLKEPQCLPGDRMGMQPESSIVWPSAVEEAPLIWTC-DTGIQLKGT-WRSQ--DGD
XM_547504_Canis.                ETAKDPKEPPCLSGDRVA----------EPVEAAHLAWTC-GTGVPSEGP-WGSPQQDRA
XM_613550_Bos.                  EAAKELKEPQYFPGDRVGVPPGTSRVWLSPMEEACLAWTC-GTAVQSKGT-WGGQPQGRD
XM_001376990_Monodelphis.       DPVEKGERYQCSPKNSFGGQFKSLVTWPSPMEEAGTTWTDPDKVVPPDGTSERKQQQEQQ
XM_415039_Gallus.               -------------------------------EPSDLSLQR-GEVVMATSG-LEGQ-----
XM_686383_Danio.                -------------------------------NDCSASWTK--TCLTKPGA-------EPT
                                                               :            :   .           

HIT000245485_Homo.          541 ALPSPELL-PQDQDKPFLRKACSPSN---IPAVIITDMG----TQED--GALEETQGSPR 590
XM_001141527_Pan.               ALPSPELL-PQDQDKPFLREACSPSN---IPAVIITDMG----TQED--GALEETQGSPR
ENSPPYT00000000173_Pongo.       AHSSPELL-PQDQDKPFLREACSPSN---IPAVIITDMG----TQED--GALEETQGSPR
XM_001089824_Macaca.            AHPSPELL-PQDQDKPFLREACSPSN---IPAVIITDMG----TQED--GALEETQGSPR
ENSMUST00000070181_Mus.         AHPSCQEMPPDQKDKASLKEACSPSNIPAIPAVIITDMG----AQED--GGLEEIQGSPR
AJ242781_Rattus.                AHPSCQEKSPDQKDK-----ACSPSNIPAIPAVIITDMG----AQED--GGLEEIQGSPR
XM_547504_Canis.                TQPSPELLSPDQKDQPSLKEACSPSS---IPAVIITDMG----AQED--GTLEDPQGSPR
XM_613550_Bos.                  AHLSPERLSPAQKDKPSLGEACGRNS---IPAVIITDMGTDADAQED--RALEEAQGSPR
XM_001376990_Monodelphis.       ENHQGKELTPESERKPSLREACYPSN---IPAVIITDMG----ALEDGEGGLEEAQGSPR
XM_415039_Gallus.               --------YPVV-----------GGS---IPAVIITDLG----------GPEEEAGAVPP
XM_686383_Danio.                TQAEPDGVSPEL------------GS---IPTVIITDDG----MEVS--GEVKEAEVSPQ
                                         *              ..   **:***** *             ::    * 

HIT000245485_Homo.          591 GNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRK 650
XM_001141527_Pan.               GNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRK
ENSPPYT00000000173_Pongo.       GNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRK
XM_001089824_Macaca.            GNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRK
ENSMUST00000070181_Mus.         GPLPLRKLSSSSASSTGFSSSYDDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRK
AJ242781_Rattus.                GPLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRK
XM_547504_Canis.                GSLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERCLDPNSAFLHTLDQQKPRVSKSWRK
XM_613550_Bos.                  GSLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERCLDPNSAFLHTLDQQKPRVSKSWRK
XM_001376990_Monodelphis.       GNMPLRKLSSSSASSTGFSSSYDDSEEDISSDPERSLDPNSAFLHTLDQQKPRVSKSWRK
XM_415039_Gallus.               SSLPVRKLSSSSASSTGFSSSWEESEEDISSDPERTLDQAPAFLQTLDQQKPRVSKSWRK
XM_686383_Danio.                TNRTLRKLSSSSASSTGFSSSWEESEDDISSDPERS----PAFLQT--QQK--AHKSWKK
                                   .:****************:::**:********     .***:*  ***  . ***:*

HIT000245485_Homo.          651 IKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRP 710
XM_001141527_Pan.               IKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRP
ENSPPYT00000000173_Pongo.       IKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRP
XM_001089824_Macaca.            IKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRP
ENSMUST00000070181_Mus.         IKNMVQWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLRP
AJ242781_Rattus.                IKNMVQWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLRP
XM_547504_Canis.                IKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLKP
XM_613550_Bos.                  IKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLKP
XM_001376990_Monodelphis.       IKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMTDVLKP
XM_415039_Gallus.               IKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMNDVLKP
XM_686383_Danio.                IKNMVHWSPFVMSFKKKYPWIQLAGHAGNFKAGANGRILKKHCECEQQCLDRLMRDILKP
                                *****:**********************.***.***********.**:****** *:*:*

HIT000245485_Homo.          711 FVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMY 770
XM_001141527_Pan.               FVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMY
ENSPPYT00000000173_Pongo.       FVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMY
XM_001089824_Macaca.            FVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMY
ENSMUST00000070181_Mus.         FVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGVRTYLEEELTKARKKPSLRKDMY
AJ242781_Rattus.                FVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMY
XM_547504_Canis.                FVPAYHGDVVKDGERYNQMDDLLAAFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMY
XM_613550_Bos.                  FVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGVRTYLEEELTKARKKPSLRKDMY
XM_001376990_Monodelphis.       FVPAYHGDVVKDGERYNQMEDLLADFDSPCVMDCKMGVRTYLEEELTKARKKPSLRKDMY
XM_415039_Gallus.               YVPAYHGDVMKDGERYNQMEDLLAEFDSPCVMDCKMGVRTYLEEELIKARKKPSLRKDMY
XM_686383_Danio.                YVPAYHGDVEKDGERYNQMEDLLADFDLPCVMDCKMGIRTYLEEELTKARKKPSLRADMY
                                :******** *********:**** ** *********:******** ********* ***

HIT000245485_Homo.          771 QKMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKT 830
XM_001141527_Pan.               QKMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKT
ENSPPYT00000000173_Pongo.       QKMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKT
XM_001089824_Macaca.            QKMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKT
ENSMUST00000070181_Mus.         QKMVEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGSVNRDFKKT
AJ242781_Rattus.                QKMVEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGSVNRDFKKT
XM_547504_Canis.                QKMIEVDPDAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGSVNRDFKKT
XM_613550_Bos.                  QKMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKVRTASLNEETEWS
XM_001376990_Monodelphis.       QKMIEVDPDAPTEEENIQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGSVNRDFKKT
XM_415039_Gallus.               QKMIEVDPDAPTEEENVLRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKT
XM_686383_Danio.                QKMIEVDPDAPTEKENEQKAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKT
                                ***:****:****:*:  :**************************** . .::*.: : :

HIT000245485_Homo.          831 KTREQVTEAFREFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQ 890
XM_001141527_Pan.               KTREQVTEAFREFTKGNRNILQELASCLRAIRTTLEVSPFFKCHEVIGSSLLFIHDQKEQ
ENSPPYT00000000173_Pongo.       KTREQVTEAFREFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQ
XM_001089824_Macaca.            KTREELLAAAEQV--GEDQVAIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQ
ENSMUST00000070181_Mus.         KTREQVTEAFREFTKGNQNILIAYRDRLKAIRATLEISPFFKCHEVIGSSLLFIHDKKEQ
AJ242781_Rattus.                KTREQVTEAFREFTKGNQNILIAYRDRLKAIRETLEVSPFFKCHEVIGSSLLFIHDKKEQ
XM_547504_Canis.                KTREQVTQAFKEFTKGNRNILIAYRDRLKDIRATLEVSPFFKCHEVIGSSLLFIHDQKEQ
XM_613550_Bos.                  RAHSKESRGAGAHTQGPGSLLIAYRDRLKDIRATLEISPFFKCHEVIGSSLLFIHDKKEQ
XM_001376990_Monodelphis.       KTKEQVTEAFREFTKGNRNILICYRDRLKDIRATLEISPFFKCHEVIGSSLLFIHDKKEQ
XM_415039_Gallus.               RTKEQVTEAFREFTRGNRNVLNSYLNRLKGIRATLETSPFFKCHEVIGSSLLFIHDKKEQ
XM_686383_Danio.                KTREQVTEAFQDFVKGNKNILHSYLNRLKEIRDTLEMSPFFKTHEVIGSSLLFVHDKREL
                                :::.:   .      *  .:     . *: ** *** ***** **********:**::* 

HIT000245485_Homo.          891 AKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEMSQDAPLA 946
XM_001141527_Pan.               AKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLIDILTEMSQDAPLA
ENSPPYT00000000173_Pongo.       AKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLIDILTEMSQDAPLA
XM_001089824_Macaca.            AKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLIDILTEMSQDAPLA
ENSMUST00000070181_Mus.         AKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLDNLIDILTEMSQGSPLT
AJ242781_Rattus.                AKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLIDILTEMSQGSPLT
XM_547504_Canis.                AKVWMIDFGKTTPLPEGQTLQHNVPWQEGNREDGYLSGLNNLIDILAEMCQGAPLT
XM_613550_Bos.                  AKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLIDILTEMCPSAPLA
XM_001376990_Monodelphis.       AKVWMIDFGKTTPLPEGQTLQHNVPWQEGNREDGYLSGLDNLIDILTEMSQSEALP
XM_415039_Gallus.               AKVWMIDFGKTTPLPEGQVLQHNVPWVEGNREDGYLWGLDNLIQILTDLSQSEDLH
XM_686383_Danio.                AKVWMIDFGKTTPLPEGQELSHRATWMEGNREDGYLYGLDHLIDIISNMLGPNP-H
                                ****************** *.* ..* ********* **::*::*::::