Alignment of orthologs
Amino acid abbreviation

[View by Jalview] (requires Java)

HIT000098082_Homo.              ------------------------------------------------------------
XM_525073_Pan.                  MD----------------------------------------------------------
ENSPPYT00000000177_Pongo.       MRPR--------------------------------------------------------
AB168419_Macaca.                ------------------------------------------------------------
AK089989_Mus.                   ------------------------------------------------------------
XM_001067807_Rattus.            ------------------------------------------------------------
XM_849606_Canis.                M-----------------------------------------------------------
XM_001491325_Equus.             MHYESELTMSLRPAPRSPGPDVREARAP--------------------------------
XR_028331_Bos.                  ------------------------------------------------------------
XM_001376905_Monodelphis.       MEAKHQAAHLKQDHGNRPQRQLNQQQRSCARLLSHGLQVEPGHNPGVQPQAEEKHQQTPA
AJ719426_Gallus.                ------------------------------------------------------------
ENSDART00000045185_Danio.       ------------------------------------------------------------
XM_001332951_Danio.             ------------------------------------------------------------
ENSORLT00000017238_Oryzias.     ------------------------------------------------------------
GSTENT00030381001_Tetraodon.    ------------------------------------------------------------
SINFRUT00000144725_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000098082_Homo.              ------------------------------------------------------------
XM_525073_Pan.                  ------------------------------------------------------------
ENSPPYT00000000177_Pongo.       -----------TEGFFPPAGASLPFSTRNKQPAVPAAAARAAEHAPGAGPGRDSGASTAP
AB168419_Macaca.                ------------------------------------------------------------
AK089989_Mus.                   ------------------------------------------------------------
XM_001067807_Rattus.            ------------------------------------------------------------
XM_849606_Canis.                ------------------------------------------------------------
XM_001491325_Equus.             ------------------------------------------------------------
XR_028331_Bos.                  ------------------------------------------------------------
XM_001376905_Monodelphis.       LAITGDQATLLTERFFRGSYALPGGRKRFRPPVIPETLGLAATKPVPSGCHRSRHLLPPR
AJ719426_Gallus.                ------------------------------------------------------------
ENSDART00000045185_Danio.       ------------------------------------------------------------
XM_001332951_Danio.             ------------------------------------------------------------
ENSORLT00000017238_Oryzias.     ------------------------------------------------------------
GSTENT00030381001_Tetraodon.    ------------------------------------------------------------
SINFRUT00000144725_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000098082_Homo.              ------------------------------------------------------------
XM_525073_Pan.                  ------------------------------------------------------------
ENSPPYT00000000177_Pongo.       PAL----------------------------------------------------RRRGS
AB168419_Macaca.                ------------------------------------------------------------
AK089989_Mus.                   ------------------------------------------------------------
XM_001067807_Rattus.            ------------------------------------------------------------
XM_849606_Canis.                ------------------------------------------------------------
XM_001491325_Equus.             ---------------------------------------------RRASAERWRDELRGS
XR_028331_Bos.                  ------------------------------------------------------------
XM_001376905_Monodelphis.       PYPVGGGEASRKKLRRKQGQARPPAQKRASNWQGWQLLYQPGARLREPWGTSAWGGRAGG
AJ719426_Gallus.                ------------------------------------------------------------
ENSDART00000045185_Danio.       ------------------------------------------------------------
XM_001332951_Danio.             ------------------------------------------------------------
ENSORLT00000017238_Oryzias.     ------------------------------------------------------------
GSTENT00030381001_Tetraodon.    ------------------------------------------------------------
SINFRUT00000144725_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000098082_Homo.              ------------------------------------------------------------
XM_525073_Pan.                  ------------------------------------------ETAEQNSSLAVGLNDQLH
ENSPPYT00000000177_Pongo.       PRGLLPPFLPPGSAGGGGRGARRGPPSAAPPPRAGAGGAGPASASRGGSSAARRRGQRAP
AB168419_Macaca.                ------------------------------------------------------------
AK089989_Mus.                   ------------------------------------------------------------
XM_001067807_Rattus.            ------------------------------------------------------------
XM_849606_Canis.                ------------------------------------------------------------
XM_001491325_Equus.             LGQPSEEGGDASPEQPGKRFRVKGLAPSPGTTGGHGPLREGPTGTRARRQPPARASRL--
XR_028331_Bos.                  ------------------------------------------------------------
XM_001376905_Monodelphis.       LGFPAPSPLPGAGANPRAPAPSRALCAAPGCPRARGPGRETGEPGEGGRERASGRESELL
AJ719426_Gallus.                ------------------------------------------------------------
ENSDART00000045185_Danio.       ------------------------------------------------------------
XM_001332951_Danio.             ------------------------------------------------------------
ENSORLT00000017238_Oryzias.     ------------------------------------------------------------
GSTENT00030381001_Tetraodon.    ------------------------------------------------------------
SINFRUT00000144725_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000098082_Homo.            1 -------------MHRGGQPL---------------------------KKRRGSFKMAEL 20
XM_525073_Pan.                  DLSRSRS----PAARSSASNI---------------------------RERRARIARGRW
ENSPPYT00000000177_Pongo.       HSNLPRKDSLRPTMHRGGQPL---------------------------KKRRGSFKMAEL
AB168419_Macaca.                --------------------------------------------------------MAEL
AK089989_Mus.                   -------------MHRGGQPL---------------------------KKRRGSFKMAEL
XM_001067807_Rattus.            -------------MHRGGQPL---------------------------KKRRGSFKMAEL
XM_849606_Canis.                -----------------------------------------------------VLSCLSV
XM_001491325_Equus.             ---RARLQTLGGPWRRGGDPAACMPCPLPDTHPVTPSASRTRMLTWASAEFRWTFPGIEL
XR_028331_Bos.                  -------------MHRGGQPL---------------------------KKRRGSFKMAEL
XM_001376905_Monodelphis.       HSNLPRKGSLRPTMHRGGQPL---------------------------KKRRGSFKMAEL
AJ719426_Gallus.                ------------------------------------------------------------
ENSDART00000045185_Danio.       --------------------------------------------------------MAEL
XM_001332951_Danio.             ------------------------------------------------------------
ENSORLT00000017238_Oryzias.     ------------------------------------------------------FKMAEM
GSTENT00030381001_Tetraodon.    -------------------------------------------------------KMAEI
SINFRUT00000144725_Takifugu.    ------------------------------------------------------FKMAEM
                                                                                            

HIT000098082_Homo.           21 DQLPD------------------------ESSSAKALVSLKEGSLSNTWNEKYSSLQKTP 56
XM_525073_Pan.                  DRVPDVATRRGLLRPAVSGRRRPSNVGFGNCSSAKALVSLKEGSLSNTWNEKYSSLQKTP
ENSPPYT00000000177_Pongo.       DQLPD------------------------ESSSAKALVSLKEGSLSNTWNEKYSSLQKTP
AB168419_Macaca.                DQLPD------------------------ESSSAKALVSLKEGSLSNTWNEKYSSLQKTP
AK089989_Mus.                   DQLPD------------------------ESSSAKALVSLKEGSLSNTWNEKYSSLQKTP
XM_001067807_Rattus.            DQLPD------------------------ESSSAKALVSLKEGSLSNTWNEKYSSLQKTP
XM_849606_Canis.                VEILCLSSAWVPAVLLVILGRCAASHGH-SGSSAKALVSLKEGSLSNTWNEKYSSLQKTP
XM_001491325_Equus.             CSFAV----------SSTVATRPVRCGA-PGSSAKALVSLKEGSLSNTWNEKYSSLQKTP
XR_028331_Bos.                  DQLPD------------------------ESSSAKALVSLKEGSLSNTWNEKYSSLQKTP
XM_001376905_Monodelphis.       DQLPD------------------------ESSSAKALVSLKEGSLSNTWNEKYSSLQKTP
AJ719426_Gallus.                ------------------------------------------------------------
ENSDART00000045185_Danio.       EQLLD------------------------ESSSAKALVSLREGSLSNTLNEK-NNLPKSQ
XM_001332951_Danio.             ------------------------------------------------------------
ENSORLT00000017238_Oryzias.     DQLLD------------------------ESSSAEALVSLKEGSLSNTLNEK-NNFPRTH
GSTENT00030381001_Tetraodon.    DQLLD------------------------ESSSAEALVSLKEGSLSNSLNEK-NSFPRAH
SINFRUT00000144725_Takifugu.    DQLLD------------------------ESSSAEALVSLKEGSLSNTLNEK-NSFPRAH
                                                                                            

HIT000098082_Homo.           57 VWKGRNTSSAVEMPFRNSKRSRLFSDEDDRQ---INT-RSPKRNQRVAMVPQKFTATMST 112
XM_525073_Pan.                  VWKGRNTSSAVEMPFRNSKRSRLFSDEDDRQ---INT-RSPKRNQRVAMVPQKFTATMST
ENSPPYT00000000177_Pongo.       VWKGRNTSPAVEMPFRNSKRSRLFSDEDDRQ---INT-RSPKRNQRVAMVPQKFTATMST
AB168419_Macaca.                VWKGRNTSPAVEMPFRNSKRSRLFSDEDDRQ---INT-RSPKRNQRVAMVPQKFTATMST
AK089989_Mus.                   VWKGRNAGPAVEMPFRNSKRSRLFSDEDDRQ---INT-KSPKRNQRVAMIPQKFTATMST
XM_001067807_Rattus.            VWKGRNAGPAVEMPFRNSKRSRLFSDEDDRQ---INT-KSPKRNQRVAMIPQKFTATMST
XM_849606_Canis.                VWKGRNTGSAVEMPFRNSKRSRLFSDEDDRQ---INT-RSPKRNQRVAMVPQKFTATMST
XM_001491325_Equus.             VWKGRNTASAVEMPFRNSKRSRLFSDEDDRQ---INT-RSPKRNQRVAMVPQKFTATMST
XR_028331_Bos.                  VWKGRNTGSAVEMPFRNSKRSRLFSDEDDRQ---INT-RSPKRNQRVAMVPQKFTATMST
XM_001376905_Monodelphis.       VWKGKNTASSVEMPFRNSKRSRLFCEDDDRQ---LST-RSPKRNQRVAMVPQKFTATMST
AJ719426_Gallus.                ---------------------------------------------------------MST
ENSDART00000045185_Danio.       TTRGRSSYVSMETPTRSSKRSRLSCEDEERP---IAS-RSPRRSQRVTTMPQKL-TNVAT
XM_001332951_Danio.             -------------PTRSSKRSRLSCEDEERP---IAS-RSPRRSQRVTTMPQKL-TNVAT
ENSORLT00000017238_Oryzias.     NTRGRHSSLTMDTPTRSSKRSRLFRDEEESPQQRLPS-RSPRRSQRVTITPQKF-SNVVT
GSTENT00030381001_Tetraodon.    NTRGRQSS-TMDTPVRSSKRSRFIREEDEHPQQRVPSTRSPRRSQRVTTPPQKF-SNVVT
SINFRUT00000144725_Takifugu.    NTRGRQSSLTMDTSTRSSKRSRLFRDEDEQPQLGVPS-RSPRRSQRVTTPPQKF-SNVVT
                                                                                         : *

HIT000098082_Homo.          113 PDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTR 172
XM_525073_Pan.                  PDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTR
ENSPPYT00000000177_Pongo.       PDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTR
AB168419_Macaca.                PDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTR
AK089989_Mus.                   PDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTR
XM_001067807_Rattus.            PDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTR
XM_849606_Canis.                PDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTR
XM_001491325_Equus.             PDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTR
XR_028331_Bos.                  PDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTR
XM_001376905_Monodelphis.       PDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTR
AJ719426_Gallus.                PDKKASQKIGLRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTR
ENSDART00000045185_Danio.       PDKRVSQKIGLRLRNLLKLPKAHKWCIYEWFYSNIDRPLFEGDNDFCLCLKESFPNLKTR
XM_001332951_Danio.             PDKRVSQKIGLRLRNLLKLPKAHKWCIYEWFYSNIDRPLFEGDNDFCLCLKESFPNLKTR
ENSORLT00000017238_Oryzias.     PDKKASQKIGLRLRNLLKLPKAHKWCIYEWFYSNIDRPLFEGDNEFCLCLKESFPNLKTR
GSTENT00030381001_Tetraodon.    PDKKASQKIGLRLRNLLKLPKAHKWCIYEWFYSNIDRPLFEGDNEFCLCLKESFPNLKTR
SINFRUT00000144725_Takifugu.    PDKKASQKIGLRLRNLLKLPKAHKWCIYEWFYSNIDRPLFEGDNEFCLCLKESFPNLKTR
                                ***:.*****:*************************:*******:**:************

HIT000098082_Homo.          173 KLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEI 232
XM_525073_Pan.                  KLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEI
ENSPPYT00000000177_Pongo.       KLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEI
AB168419_Macaca.                KLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEI
AK089989_Mus.                   KLTRVEWGKIRRLMGKPRRCSSAFLEEERSALKQKGQKIRLLQQRKVADVSQFKDLPDEI
XM_001067807_Rattus.            KLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEI
XM_849606_Canis.                KLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEI
XM_001491325_Equus.             KLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEI
XR_028331_Bos.                  KLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEI
XM_001376905_Monodelphis.       KLTRVEWGKIRRLMGKPRRCSSAFFEEERAALKQKRQKIRLLQQRKVADVSQFKDLPDEI
AJ719426_Gallus.                KLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADISQFKDLPDEI
ENSDART00000045185_Danio.       KLTRVEWGTIRRLMGKPRRCSSAFFAEERMALKQKRQKMRLLQQRKITDMSLCKDLPDEI
XM_001332951_Danio.             KLTRVEWGTIRRLMGKPRRCSSAFFAEERMALKQKRQKMRLLQQRKITDMSLCKDLPDEI
ENSORLT00000017238_Oryzias.     KLTRVEWGTIRRLMGKPRRCSSAFFAEERTALRQKRQKMRLLQQRKLSDLSNCKDLPEEI
GSTENT00030381001_Tetraodon.    KLTRVEWGTIRRLMGKPRRCSSAFFVEERTALRQKRQKMRLLQQGKISDVSNCKDLPDEI
SINFRUT00000144725_Takifugu.    KLTRVEWGTIRRLMGKPRRCSSAFFVEERTALRQKRQKMRLLQQGKISDVSNCKDLPDEI
                                ********.***************: *** **:** **:***** *::*:*  ****:**

HIT000098082_Homo.          233 PLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEP 292
XM_525073_Pan.                  PLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEP
ENSPPYT00000000177_Pongo.       PLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEP
AB168419_Macaca.                PLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEP
AK089989_Mus.                   PLPLVMGTKVTARLRGIHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEP
XM_001067807_Rattus.            PLPLVIGTKVTARLRGIHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEP
XM_849606_Canis.                PLPLVIGTKVTARLRGVHDGLFTGQIDAVDTFNATYRVTFDRAGLGTHTIPDYEVLSNEP
XM_001491325_Equus.             PLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRAGLGTHTIPDYEVLSNEP
XR_028331_Bos.                  PLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRAGLGTHTIPDYEVLSNEP
XM_001376905_Monodelphis.       PLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRAGLGTHTVPDYEVLSNEP
AJ719426_Gallus.                PLPLVIGTKVTARLRGVHDGLFTGQIEAVDTLNATYRVTFDRAGLGTQTIPDYEVLSNEP
ENSDART00000045185_Danio.       PLPLVIGTKVTARLRGVHDGLFTGQIDAVDTSAATYRVTFDRNGLGTHTVPDYEVLSNEP
XM_001332951_Danio.             PLPLVIGTKVTARLRGVHDGLFTGQIDAVDTSAATYRVTFDRNGLGTHTVPDYEVLSNEP
ENSORLT00000017238_Oryzias.     PLPLIIGTKVTARLRGNHDGLFTGQIDAVDTSAATYRVTFDRTGLGTHTVPDYEVLSNEP
GSTENT00030381001_Tetraodon.    PLRLNIGTKVTARLRGAHDGLFTGQIDAVDTTAATYRVTFDRNGLGTHTVPDYEVLSNEP
SINFRUT00000144725_Takifugu.    PLRLNIGTKVTARLRGAHDGLFTGQIDAVDTTAATYRVTFDRNGLGTHTVPDYEVLSNEP
                                ** * :********** *********:****  ********* ****:*:**********

HIT000098082_Homo.          293 HETMPIAAFGQKQRPSRF---FMTPPRLHYTPPLQSPIIDNDPLLGQSPWRSKISGSDTE 349
XM_525073_Pan.                  HETMPIAAFGQKQRPSRF---FMTPPRLHYTPPLQSPIIDNDPLLGQSPWRSKISGSDTE
ENSPPYT00000000177_Pongo.       HETMPIAAFGQKQRPSRF---FMTPPRLHYTPPLQSPIIDNDPLLGQSPWRSKISGSDTE
AB168419_Macaca.                HETMPIAAFGQKQRPSRF---FMTPPRLHYTPPLQSPIMDNDPLLGQSPWRSKISGSDTE
AK089989_Mus.                   HETMPISAFGQKQRPSRF---FMTPPRLHYTPPLQSPITDGDPLLGQSPWRSKVSGSDTE
XM_001067807_Rattus.            HETMPIAAFGQKQRPSRF---FMTPPRLHYTPPLQSPITDGDPLLGQSPWRSKISGSDTE
XM_849606_Canis.                HETMPIAAFGQKQRPSRF---FMTPPRLHYTPPLQSPITDNDPLLGQSPWRSKISGSDTE
XM_001491325_Equus.             HETMPIAAFGQKQRPSRF---FMTPPRLHYTPPLQSPITDNDPLLGQSPWRSKISGSETE
XR_028331_Bos.                  HETMPIAAFGQKQRPSRF---FMTPPRLHYTPPLQSPIQDNDPLLGQSPWRSKISGSDTE
XM_001376905_Monodelphis.       HETMPIAAFGQKQRPSRF---FMTPPRLHYTPPLQSPITDNDPLLGQSPWRSKLPGSDTE
AJ719426_Gallus.                HETMPIAAFGQKQRPSRF---FMTPPRLHYTPSLQSPITDSDPLLGQSSWKNKISGTDSE
ENSDART00000045185_Danio.       HETMPISAFAQKQRPPRF-QNFLTPPRGSYTGSTQSILMDNDPLFSQSPWRSKLTGTDGE
XM_001332951_Danio.             HETMPISAFAQKQRPPRF-QNFLTPPRGSYTGSTQSILMDNDPLFSQSPWRSKLTGTDGE
ENSORLT00000017238_Oryzias.     NETMPISAFAQKHRSARYMQNVMTPPRATYPSVTTPVHMDNDPLMSQSPWRNKLSCSEGE
GSTENT00030381001_Tetraodon.    NETMPISAFAQKHRTTRYMQNLMTPPRGPYPSATTPVL----------------------
SINFRUT00000144725_Takifugu.    NETMPISAFAQKHRTTRYMQNLMTPPRGPYPPATPPVLMDNDPLINQSPWRNKLPGAEGE
                                :*****:**.**:*..*:   .:****  *.    .                        

HIT000098082_Homo.          350 TLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVL 409
XM_525073_Pan.                  TLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVL
ENSPPYT00000000177_Pongo.       TLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVL
AB168419_Macaca.                TLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTDAEKLKSYSMPISIEFQRRYATIVL
AK089989_Mus.                   TLGGFPVEFLIQVTKLSKILMIKKEHIKKLREMNTEAEKLKSYSMPIGIEFQRRYATIVL
XM_001067807_Rattus.            TLGGFPVEFLIQVTKLSKILMIKKEHIKKLREMNTEAEKLKSYSMPIGIEFQRRYATIVL
XM_849606_Canis.                TLGGFPVEFLIQVTKLSKILMIKKEHIKKLREMNTEAEKLKSYSMPIGIEFQRRYATIVL
XM_001491325_Equus.             TLGGFPVEFLIQVTKLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVL
XR_028331_Bos.                  TLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPIGIEFQRRYATIVL
XM_001376905_Monodelphis.       TLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVL
AJ719426_Gallus.                TLGGFPVEFLIQVTRLSKILMIKKEHIKQLREMNTEAEKLKSYSMPISIEFQRRYATIVL
ENSDART00000045185_Danio.       TLGGFPVKFLVQVTRLSKILMIKKEHIKHLKEMNTEAEKLKSYSMPIGLDLQKRYATTVL
XM_001332951_Danio.             TLGGFPVKFLVQVTRLSKILMIKKEHIKHLKEMNTEAEKLKSYSMPIGLDLQKRYATTVL
ENSORLT00000017238_Oryzias.     TLGGFPVKFLVQVTRLSKILMIKKEHIKHLKEMNTEAERLKSYSMPIDLDFQKRYAITVL
GSTENT00030381001_Tetraodon.    ---------------------------------------MKSYSMSIDIDFQRRYATTVL
SINFRUT00000144725_Takifugu.    TLGGFPVKFLVQVTRLSKILMIKKEHIKHLKEMNTEAEKMKSYSMSIDLDFQRRYATTVL
                                                                       :*****.*.:::*:***  **

HIT000098082_Homo.          410 ELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSS-TGQ 468
XM_525073_Pan.                  ELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSS-TGQ
ENSPPYT00000000177_Pongo.       ELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSS-TGQ
AB168419_Macaca.                ELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSS-TGQ
AK089989_Mus.                   ELEQLNKDLNQVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRQANSA-SGQ
XM_001067807_Rattus.            ELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRQANSA-SGQ
XM_849606_Canis.                ELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSS-TGQ
XM_001491325_Equus.             ELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSS-TGQ
XR_028331_Bos.                  ELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSS-TGQ
XM_001376905_Monodelphis.       DLEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANAS-TGQ
AJ719426_Gallus.                DLEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDLRRRCEEEAQEIVRQANSSTTGQ
ENSDART00000045185_Danio.       DLEQLNKDLNKVLHEVQQFCFELAPDQGMQPADQPSELRRRCEEESQDVLRQNNTLASGE
XM_001332951_Danio.             DLEQLNKDLNKVLHEVQQFCFELAPDQGMQPADQPSELRRRCEEESQDVLRQNNTLASGE
ENSORLT00000017238_Oryzias.     ELDQLNKDLNKVFHEVQQFCCDLSPDQGMVPADHPTELRRRCEEQAQQMVQMYNPQWDGQ
GSTENT00030381001_Tetraodon.    ELEQLNKDLNKVLHEVQQYCCELAPDQGMVPADHPTELRRRCEEEAQQMVQMSGISKDGQ
SINFRUT00000144725_Takifugu.    ELEQLNKDLNKVLHEVQQYCCELAPDQGMVPVDHPTELRRRCEEEAQQMVQMSSISKDGQ
                                :*:*******:*:*:***:* :*:****: *.*:*:::******::*::::  .    *:

HIT000098082_Homo.          469 PCVENENLTDLISRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQN 528
XM_525073_Pan.                  PCVENENLTDLISRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQN
ENSPPYT00000000177_Pongo.       PCVENENLTDLISRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQN
AB168419_Macaca.                PCVENENLTDLISRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQN
AK089989_Mus.                   PCVENENLTDLISRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKNTIDASNISCFQN
XM_001067807_Rattus.            PCVENENLTDLISRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKNTIDASNISCFQN
XM_849606_Canis.                PCVENENLTDLISRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQN
XM_001491325_Equus.             PCVENENLTDLISRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQN
XR_028331_Bos.                  PCVENENLTDLISRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQN
XM_001376905_Monodelphis.       PCVENENLTELISRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKSSIDASNISCFQN
AJ719426_Gallus.                LCVESENLTDLISRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKNSIDSSNISCFQN
ENSDART00000045185_Danio.       PRVQNTELTQLISRLTALLLQIRCLAEGGDLNSFEFKSLTDSLNDIKSSIDDSNLSCFQD
XM_001332951_Danio.             PRVQNTELTQLISRLTALLLQIRCLAEGGDLNSFEFKSLTDSLNDIKSSIDDSNLSCFQD
ENSORLT00000017238_Oryzias.     HIITNPGLTSLISRLTALLLQIKCLADEGDLNSFEFKSLTDSLNDIKASVDPSNLSCFQN
GSTENT00030381001_Tetraodon.    QGATSSRLTHLISRLTALLLQIKCLADGGDLNSFEFKSLTDSLNDIKASIDPSNLSCFQN
SINFRUT00000144725_Takifugu.    QGATNPSLTHLISRLTAVLLQIKCLADGGDLNSFEFKSLTDSLNDIKASIDPSNLSCFQN
                                    .  ** *******:****:***: ******************* ::* **:****:

HIT000098082_Homo.          529 NVEIHVAHIQSGLSQMGNLHAFAANNTNRD 558
XM_525073_Pan.                  NVEIHVAHIQSGLSQMGNLHAFAANNTNRD
ENSPPYT00000000177_Pongo.       NVEIHVAHIQSGLSQMGNLHAFAANNTNRD
AB168419_Macaca.                NVEIHVAHIQSGLSQMGNLHAFAANNTNRD
AK089989_Mus.                   NVEIHVAHIQSGLSQMGNLHAFAANNTNRD
XM_001067807_Rattus.            NVEIHVAHIQSGLSQMGNLHAFAANNTNRD
XM_849606_Canis.                NVEIHVAHIQSGLSQMGNLHAFAANDTNRD
XM_001491325_Equus.             NVEIHVAHIQSGLSQMGNLHAFAANNTNRD
XR_028331_Bos.                  NVEIHVAHIQSGLSQMGNLHAFAANNTNRD
XM_001376905_Monodelphis.       NVEIHVAHIQSGLSQMGNLHAFAANNTNRD
AJ719426_Gallus.                NVEIHVAHIQSGLSQMGNLHAFAANNTNRD
ENSDART00000045185_Danio.       NVEIHVAHIQSGLSQLGNLHAFSANNTNRT
XM_001332951_Danio.             NVEIHVAHIQSGLSQLGNLHAFSANNTNRT
ENSORLT00000017238_Oryzias.     NVEIHVAHIQSGLSQLGNLHAFAANNTNAV
GSTENT00030381001_Tetraodon.    NVEIHVAHIQSGLSQLGNLHAFTANNTNAV
SINFRUT00000144725_Takifugu.    NVEIHVAHIQSGLSQLGNLHAFTANNTN--
                                ***************:******:**:**