Alignment of orthologs
Amino acid abbreviation

[View by Jalview] (requires Java)

HIT000043929_Homo.            1 ----------------------------------------------MQVDLILWTIHFQL 14
XM_001093778_Macaca.            MTEPAYPITAPGEKGEAMSEIIEKSFSLKYLDVQRWEWPQQGEDCAMQVDLILWTIHFQL
                                                                              **************

HIT000043929_Homo.           15 GSSLTFNLKHQKTRLTAASAYRGLFFSCNKKNRSGR-RPSSQGLSFFLSHQPYHVGLSSL 73
XM_001093778_Macaca.            GSSLTFNLKHQKTRLTAASAYRSLFFSCNKKNRSGQSRPNPQGLSFFLSHQPYLVGFSSL
                                **********************.************: **..************ **:***

HIT000043929_Homo.           74 CLLPHDGKMAAAPLGLTTDF------------------------------ 93
XM_001093778_Macaca.            CLLPYGGKMAAAPLGLTIDFYAQSSGPVRDAHMLKSSFCSSALNSSCGLI
                                ****:.*********** **