Alignment of orthologs
Amino acid abbreviation

[View by Jalview] (requires Java)

HIT000041571_Homo.              ------------------------------------------------------------
XM_520248_Pan.                  MSLQQRSIEQSKLLICGVGERFCKLP----------------------------------
ENSPPYT00000022867_Pongo.       ------------------------------------------------------------
XM_001082881_Macaca.            ------------------------------------------------------------
AK134378_Mus.                   ------------------------------------------------------------
XM_001055033_Rattus.            ------------------------------------------------------------
XM_846937_Canis.                MK----------------------------------------------------------
D13569_Bos.                     ------------------------------------------------------------
XM_001371666_Monodelphis.       MRFFAQPLWMHFCPPPSAGRLSGGLSSPPLPSPGPPPLGGLARRAHRDTGRGLGEKTLKA
AB002404_Gallus.                ------------------------------------------------------------
AF198086_Danio.                 ------------------------------------------------------------
BC124756_Danio.                 MRHKRDRQHELK------------------------------------------------
AB016834_Oryzias.               ------------------------------------------------------------
ENSORLT00000016541_Oryzias.     ------------------------------------------------------------
GSTENT00020031001_Tetraodon.    ------------------------------------------------------------
GSTENT00034373001_Tetraodon.    ------------------------------------------------------------
SINFRUT00000132871_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000041571_Homo.              ------------------------------------------------------------
XM_520248_Pan.                  ---------------------------------------LYKSSFTNVCSRFHRTKSPF-
ENSPPYT00000022867_Pongo.       ------------------------------------------------------------
XM_001082881_Macaca.            ------------------------------------------------------------
AK134378_Mus.                   ------------------------------------------------------------
XM_001055033_Rattus.            ------------------------------------------------------------
XM_846937_Canis.                ------------------------------------------------------------
D13569_Bos.                     ------------------------------------------------------------
XM_001371666_Monodelphis.       TEEAVGQGEVVRGLGPGWDTHLPKACHHPFAPNQREETGLQLTEGADEWPELGKSQKTLK
AB002404_Gallus.                ------------------------------------------------------------
AF198086_Danio.                 ------------------------------------------------------------
BC124756_Danio.                 ------------------------------------------------------------
AB016834_Oryzias.               -----------------------------------------------------------M
ENSORLT00000016541_Oryzias.     -----------------------------------------------------------L
GSTENT00020031001_Tetraodon.    ------------------------------------------------------------
GSTENT00034373001_Tetraodon.    ------------------------------------------------------------
SINFRUT00000132871_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000041571_Homo.            1 ------------MDYSYDEDLDE--LC--------------------------------- 13
XM_520248_Pan.                  ------------IAESPAESLSQVAVCSEPEPDLWTVFNVFCTSPFMTWAFFKQGKVNVL
ENSPPYT00000022867_Pongo.       ------------MDYSYDEDLDE--LC---------------------------------
XM_001082881_Macaca.            ------------MDYSYDEDLDE--LC---------------------------------
AK134378_Mus.                   ------------MDYSYDEDLDE--LC---------------------------------
XM_001055033_Rattus.            ------------MDYSYDEDLDE--LC---------------------------------
XM_846937_Canis.                ------------LEKSADDDRAEQRTC---------------------------------
D13569_Bos.                     ------------MDYSYDEDLDE--LC---------------------------------
XM_001371666_Monodelphis.       HGLTPVLTSLRGMDYSYDEDLDE--LC---------------------------------
AB002404_Gallus.                ------------MDYSYDEDLDE--LC---------------------------------
AF198086_Danio.                 ------------MDFRADEDLEE--LC---------------------------------
BC124756_Danio.                 ------------PDPESSATQEE--GC---------------------------------
AB016834_Oryzias.               LGDKAHGVTLKVMEYTYDEDLEE--LC---------------------------------
ENSORLT00000016541_Oryzias.     IPCVSVSALLCRMEFGCEVDLEE--LC---------------------------------
GSTENT00020031001_Tetraodon.    ---------LKVMEYTYDDDLEE--MC---------------------------------
GSTENT00034373001_Tetraodon.    ---------------------EE--SC---------------------------------
SINFRUT00000132871_Takifugu.    ---------LKVMEYTYDDDLEE--LC---------------------------------
                                                      :   *                                 

HIT000041571_Homo.              ------------------------------------------------------------
XM_520248_Pan.                  HCKLRLLESFARFSGLVLNLEKFPRICLKALNLAQRAPSPYAPLTREVGKPPGIGGSKQD
ENSPPYT00000022867_Pongo.       ------------------------------------------------------------
XM_001082881_Macaca.            ------------------------------------------------------------
AK134378_Mus.                   ------------------------------------------------------------
XM_001055033_Rattus.            ------------------------------------------------------------
XM_846937_Canis.                ------------------------------------------------------------
D13569_Bos.                     ------------------------------------------------------------
XM_001371666_Monodelphis.       ------------------------------------------------------------
AB002404_Gallus.                ------------------------------------------------------------
AF198086_Danio.                 ------------------------------------------------------------
BC124756_Danio.                 ------------------------------------------------------------
AB016834_Oryzias.               ------------------------------------------------------------
ENSORLT00000016541_Oryzias.     ------------------------------------------------------------
GSTENT00020031001_Tetraodon.    ------------------------------------------------------------
GSTENT00034373001_Tetraodon.    ------------------------------------------------------------
SINFRUT00000132871_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000041571_Homo.              ------------------------------------------------------------
XM_520248_Pan.                  PPCPVSQNQSKEWGILRVSVASLNVTYSTSTCLSPATLFQGGPGTPLSPRPPSAFFLAPP
ENSPPYT00000022867_Pongo.       ------------------------------------------------------------
XM_001082881_Macaca.            ------------------------------------------------------------
AK134378_Mus.                   ------------------------------------------------------------
XM_001055033_Rattus.            ------------------------------------------------------------
XM_846937_Canis.                ------------------------------------------------------------
D13569_Bos.                     ------------------------------------------------------------
XM_001371666_Monodelphis.       ------------------------------------------------------------
AB002404_Gallus.                ------------------------------------------------------------
AF198086_Danio.                 ------------------------------------------------------------
BC124756_Danio.                 ------------------------------------------------------------
AB016834_Oryzias.               ------------------------------------------------------------
ENSORLT00000016541_Oryzias.     ------------------------------------------------------------
GSTENT00020031001_Tetraodon.    ------------------------------------------------------------
GSTENT00034373001_Tetraodon.    ------------------------------------------------------------
SINFRUT00000132871_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000041571_Homo.           14 ----------------------------------------------PVC----------- 16
XM_520248_Pan.                  PRESSEGSSGALPPGSSPSSCARRGFGSPQASDISSATVATRPYPLPRCSATSHPRGIRH
ENSPPYT00000022867_Pongo.       ----------------------------------------------PVC-----------
XM_001082881_Macaca.            ----------------------------------------------PVC-----------
AK134378_Mus.                   ----------------------------------------------PVC-----------
XM_001055033_Rattus.            ----------------------------------------------PVC-----------
XM_846937_Canis.                ----------------------------------------------LIC-----------
D13569_Bos.                     ----------------------------------------------PVC-----------
XM_001371666_Monodelphis.       ----------------------------------------------PVC-----------
AB002404_Gallus.                ----------------------------------------------PVC-----------
AF198086_Danio.                 ----------------------------------------------PVC-----------
BC124756_Danio.                 ----------------------------------------------PVC-----------
AB016834_Oryzias.               ----------------------------------------------PVC-----------
ENSORLT00000016541_Oryzias.     ----------------------------------------------PVC-----------
GSTENT00020031001_Tetraodon.    ----------------------------------------------PVC-----------
GSTENT00034373001_Tetraodon.    ----------------------------------------------PIC-----------
SINFRUT00000132871_Takifugu.    ----------------------------------------------PVC-----------
                                                                                *           

HIT000041571_Homo.           17 ------------------------------------------GDKVSGYHYGLLTCES-- 32
XM_520248_Pan.                  DPAGFTDRSCLLPLQAGDPRPPQPYTCPDRGALGLRSSLAALGVRGAGLRLGGLEDEGED
ENSPPYT00000022867_Pongo.       ------------------------------------------GDKVSGYHYGLLTCES--
XM_001082881_Macaca.            ------------------------------------------GDKVSGYHYGLLTCES--
AK134378_Mus.                   ------------------------------------------GDKVSGYHYGLLTCES--
XM_001055033_Rattus.            ------------------------------------------GDKVSGYHYGLLTCES--
XM_846937_Canis.                ------------------------------------------GDRATGLHYGIISCEG--
D13569_Bos.                     ------------------------------------------GDKVSGYHYGLLTCES--
XM_001371666_Monodelphis.       ------------------------------------------GDKVSGYHYGLLTCES--
AB002404_Gallus.                ------------------------------------------GDKVSGYHYGLLTCES--
AF198086_Danio.                 ------------------------------------------GDKVSGYHYGLLTCES--
BC124756_Danio.                 ------------------------------------------GDRVSGYHYGLLTCES--
AB016834_Oryzias.               ------------------------------------------GDKVSGYHYGLLTCES--
ENSORLT00000016541_Oryzias.     ------------------------------------------GDKVSGYHYGLLTCES--
GSTENT00020031001_Tetraodon.    ------------------------------------------GDKVSGYHYGLLTCES--
GSTENT00034373001_Tetraodon.    ------------------------------------------GDKVSGYHYGLLTCES--
SINFRUT00000132871_Takifugu.    ------------------------------------------GDKVSGYHYGLLTCES--
                                                                          * : :* : * :  *.  

HIT000041571_Homo.           33 --------CK--------------------------GFFKRTVQNNKHYTCTESQSCKID 58
XM_520248_Pan.                  SSWTAERLPQ--------------------------GFFKRTVQNNKHYTCTESQSCKID
ENSPPYT00000022867_Pongo.       --------CK--------------------------GFFKRTVQNNKHYTCTESQSCKID
XM_001082881_Macaca.            --------CK--------------------------GFFKRTVQNNKHYTCTESQSCKID
AK134378_Mus.                   --------CK--------------------------GFFKRTVQNNKHYTCTESQSCKID
XM_001055033_Rattus.            --------CK--------------------------GFFKRTVQNNKHYTCTESQSCKID
XM_846937_Canis.                --------CK--------------------------GFFKRSICNKRPYTCTESQSCKID
D13569_Bos.                     --------CK--------------------------GFFKRTVQNNKHYTCTESQSCKID
XM_001371666_Monodelphis.       --------CK--------------------------GFFKRTVQNNKHYTCTESQNCKID
AB002404_Gallus.                --------CK--------------------------GFFKRTVQNNKHYTCTESQNCKID
AF198086_Danio.                 --------CK--------------------------GFFKRTVQNNKRYTCTQNQDCGID
BC124756_Danio.                 --------CK--------------------------GFFKRSVQNNKRYTCAEAQNCPMD
AB016834_Oryzias.               --------CK--------------------------GFFKRTVQNNKRYTCAENQECKID
ENSORLT00000016541_Oryzias.     --------CK--------------------------GFFKRTVQNNKIYACVDKQQCRID
GSTENT00020031001_Tetraodon.    --------CK--------------------------GFFKRTVQNNKRYTCAENQECKID
GSTENT00034373001_Tetraodon.    --------CKVKGLKSQSKKQSFTVSCRVTVGVTLQGFFKRSVQNNKNYTCAEQQNCPMN
SINFRUT00000132871_Takifugu.    --------CK--------------------------GFFKRTVQNNKRYTCAENQECKID
                                         :                          *****:: *:: *:*.: *.* ::

HIT000041571_Homo.           59 KTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK----KAQIR 114
XM_520248_Pan.                  KTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK----KAQIR
ENSPPYT00000022867_Pongo.       KTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK----KAQIR
XM_001082881_Macaca.            KTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK----KAQIR
AK134378_Mus.                   KTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK----KAQIR
XM_001055033_Rattus.            KTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK----KAQIR
XM_846937_Canis.                KTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK----KAQIR
D13569_Bos.                     KTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK----KAQIR
XM_001371666_Monodelphis.       KTQRKRCPYCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK----KALIR
AB002404_Gallus.                KTQRKCCPYCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK----KALIR
AF198086_Danio.                 KTQRKRCPFCRFQKCLSVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK----RALIR
BC124756_Danio.                 LAQRKRCPYCRFQKCVAVGMKKEAVRADRMRGGRNKFGPLYRRDRQLKQQRGTYHQANIA
AB016834_Oryzias.               KTQRKRCPFCRFQKCLNVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK----KALIR
ENSORLT00000016541_Oryzias.     KAQRKRCPFCRFQKCLHVGMRIEAVRADRMRGGRNKFGPTYKRDRALKQQQ---REAYIR
GSTENT00020031001_Tetraodon.    KTQRKRCPFCRFQKCLSVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK----KALIR
GSTENT00034373001_Tetraodon.    LSQRKRCPFCRFQKCLAVGMRKEAVRADRMRGGRNKFGPLYRRDRQMKQQK-VLHQTTPE
SINFRUT00000132871_Takifugu.    KTQRKRCPFCRFQKCLSVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK----KALIR
                                 :*** **:******: ***: ***************** *:*** :***:    .:   

HIT000041571_Homo.          115 ANGFKLETGPPMGVPPPPPPAP-DYVLPPSLHG--PEPKG-LAAGPP---------AGPL 161
XM_520248_Pan.                  ANGFKLETGPPMGVPPPPPPAP-DYVLPPSLHA--PEPKG-LAAGPP---------AGPL
ENSPPYT00000022867_Pongo.       ANGFKLETGPPMGMPPPPPPAP-DYVLPPNLHA--PEPKG-LAAGPP---------AGPL
XM_001082881_Macaca.            ANGFKLETGPPMGVPPPPPPAP-DYVLPPSLHA--PEPKG-LAAGPP---------TGPL
AK134378_Mus.                   ANGFKLETGPPMGVPPPPPPPP-DYMLPPSLHA--PEPKA-LVSGPP---------SGPL
XM_001055033_Rattus.            ANGFKLETGPPMGVPPPPPPPP-DYMLPPSLHA--PEPKA-LVSGPP---------SGPL
XM_846937_Canis.                ANGFKLETGPPMGVPPPPPPPP-DYMLPPGLHA--PEPKG-LASGPP---------AGPL
D13569_Bos.                     ANGFKLETGPPVGVPPPPPPPP-DYMLPHGLHA--SEPKG-LASGPP---------AGPL
XM_001371666_Monodelphis.       ANGFKLETGPPM----GPPPQT-DYPLPPTLH---PGAKG-LAPAPP---------AGPP
AB002404_Gallus.                ANGFKLETVPQI----VSPVQN-DYGLSSTIHSIHAMAKT-LPPNPA---------ALTP
AF198086_Danio.                 ASGFKLEANGTL----LSGQTE-------------FSSVGLQSPYDC-------------
BC124756_Danio.                 PYRVKIEGPQQL----VPALPH-DFHV---INPNPAS-LGTDHYHPTQHFHPNMSQSEFP
AB016834_Oryzias.               SNGFKLESTALP---SASPLQT-DYSFTGTLHTLPTISKSLLPSTTS---------SVTP
ENSORLT00000016541_Oryzias.     AHRFRTESGTPV----ASWIQNGDFTFTESLNTVTIQ----KLSTPS-------LQSFGP
GSTENT00020031001_Tetraodon.    SNGFKLESALPL---PASPLQG-DYS---SLHSLPTISKGLLPSTPS---------SITP
GSTENT00034373001_Tetraodon.    P-QIKTESTQMQ----RPAAPN-DFYL---MSAHASSETGRQPSYPSSP-----AQSVVP
SINFRUT00000132871_Takifugu.    SSGFKLESALPP---PASPLQS-DYG---GLHSLPTISKGLLPSTPS---------SITP
                                .  .: *          .                                          

HIT000041571_Homo.          162 GD----------FGAPALP--------------------------------MAVPGAHGP 179
XM_520248_Pan.                  GD----------FGAPALP--------------------------------MAVPGAHGP
ENSPPYT00000022867_Pongo.       GD----------FGAPALP--------------------------------MAVPGAHGP
XM_001082881_Macaca.            GD----------FGAPALP--------------------------------MAVPGAHGP
AK134378_Mus.                   GD----------FGAPSLP--------------------------------MAVPGPHGP
XM_001055033_Rattus.            GD----------FGAPSLP--------------------------------MAVPGPHGP
XM_846937_Canis.                GD----------FGAPALP--------------------------------MAVPSAHGP
D13569_Bos.                     GD----------FGAPALP--------------------------------MAVPSAHGP
XM_001371666_Monodelphis.       GDYD-----RGPYGPPALP--------------------------------MAVP-THGP
AB002404_Gallus.                ADYE-----RGPYGTPSLA--------------------------------MTVP-GHTP
AF198086_Danio.                 -------------PPPALG--------------------------------VALQ-NYGS
BC124756_Danio.                 VLLDCTMPRDRTFSDPSLPIHTVCYPGIH-----GYTPDKREIPFNYNPASVTPPGPMSP
AB016834_Oryzias.               TDYE-----ANLYGPTSLG--------------------------------MAMQ-SHVP
ENSORLT00000016541_Oryzias.     TGAI--------------------------------------------------------
GSTENT00020031001_Tetraodon.    TDYE-----ANLYGPSPVG--------------------------------MAVQ-THVP
GSTENT00034373001_Tetraodon.    MPLD----SDNVFASPALP-----YPGLYHRTFPGYLQDKGDIPYSFSVAATMCPVHQSP
SINFRUT00000132871_Takifugu.    TDYE-----ANLYGPSPVG--------------------------------MAMQ-THVP
                                                                                            

HIT000041571_Homo.          180 L-AGYLYPAFP-GRAIKSEYPEPYASPP-QPGLPYGYPEPFSGG--------PNVPELIL 228
XM_520248_Pan.                  L-AGYLYPAFP-GRAIKSEYPEPYASPP-QPGLPYGYPEPFSGG--------PNVPELIL
ENSPPYT00000022867_Pongo.       L-AGYLYPAFP-GRAIKSEYPEPYASPP-QPGLPYGYPEPFSGG--------PNVPELIL
XM_001082881_Macaca.            L-AGYLYPAFP-GRAIKSEYPEPYASPP-QPGLPYGYPEPFSGG--------PNVPELIL
AK134378_Mus.                   L-AGYLYPAFS-NRTIKSEYPEPYASPPQQPGPPYSYPEPFSGG--------PNVPELIL
XM_001055033_Rattus.            L-AGYLYPAFS-NRTIKSEYPEPYASPPQQPGPPYSYPEPFSGG--------PNVPELIL
XM_846937_Canis.                L-AGYLYPSFP-GRAIKSEYPEPYASPP-QPGPPYGYPEPFSGG--------PGVPELIL
D13569_Bos.                     L-AGYLYPAFP-GRAIKSEYPEPYASPP-QPGPPYGYPEPFSGG--------PGVPELIL
XM_001371666_Monodelphis.       L-AGYLYPAFP-GRAIKSEYPEPYASPH-DPAPPYGYPEPYPSGPGL-----PGVPELIL
AB002404_Gallus.                L-AGYHYPSFP-NRAIKSEYPDHYSAAH-EAVPTYAYPETYPSSSP------PDIPEVIL
AF198086_Danio.                 FPAQYQYTAPSLPKSIKAEYPDAYPSSP-DSTLGYSYADGCLSASPHSVPINPALPPLVL
BC124756_Danio.                 T------VLST-PAPTLTP-ASTPSSTP--------TPSQSLTPTSTT----APSSFFLN
AB016834_Oryzias.               LNPQYQYTAFP-SRAIKAECPD-YTSSP-ESLTGYPYPDVYPSASPQP----PSLPPLVL
ENSORLT00000016541_Oryzias.     ---QNLCSSAS-SWTIKSMYSNTYAGSA--VVDAVTLMEPCDPCSKLRFTQDPRMPPLVM
GSTENT00020031001_Tetraodon.    LSAQYQYTAFS-SRAIKAECPD-YTSSN-ESLAGYPYPDPYPSASPQP----PSLPPLVV
GSTENT00034373001_Tetraodon.    N-SSFPYRSTP-PSSSSTPSASSCSSAP-----PLKTPAQNPDASPPS----AATQNFLS
SINFRUT00000132871_Takifugu.    LTAQYQYTAFS-SRAIKAECPD-YTSSP-ESLTGYPYPDPYPSTSPQP----PGLPPLVV
                                          .   .  :  ..  ...                         .    .: 

HIT000041571_Homo.          229 QLLQLEPDEDQVRARILGCLQ--EPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVF 286
XM_520248_Pan.                  QLLQLEPDEDQVRARILGCLQ--EPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVF
ENSPPYT00000022867_Pongo.       QLLQLEPDEDQVRARILGCLQ--EPTKSRPDQPAFFGLLCRMADQTFISIVDWARRCMVF
XM_001082881_Macaca.            QLLQLEPDEDQVRARILGCLQ--EPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVF
AK134378_Mus.                   QLLQLEPEEDQVRARIVGCLQ--EPAKSRSDQPAPFSLLCRMADQTFISIVDWARRCMVF
XM_001055033_Rattus.            QLLQLEPEEDQVRARIVGCLQ--EPAKSRPDQPAPFSLLCRMADQTFISIVDWARRCMVF
XM_846937_Canis.                QLLQLEPDEDQVRARIVGCLQ--EPAKGRPDQPAPFSLLCRMADQTFISIVDWARRCMVF
D13569_Bos.                     QLLQLEPDEDQVRARIVGCLQ--EPAKGRPDQPAPFSLLCRMADQTFISIVDWARRCMVF
XM_001371666_Monodelphis.       KLLQLEPDEGQLKARILACLQ--EPAKGRPDRPTPFGLMCKMADQTLFSIVEWARSCVVF
AB002404_Gallus.                KLLQLEPDEAQVKARILACLQQ-EQGKGRHEKLSTFGLMCKMADQTLFSIVEWARSCIFF
AF198086_Danio.                 ELQSCDPDEEQVRGKICAYLHQEQSGRGKLEKSRPSSLLCVMADQTLFSIVEWARSCVFF
BC124756_Danio.                 QLLQAEPDEKQLCMRVLASLQREQACRGKHDRLNTFSIMCKMADQTLFGLVEWARNCELF
AB016834_Oryzias.               ELLRCDPDELVVQNKIVAHLQQEQSNRGRLDKPSTFSLMCRMADQTLFSIVEWARSCIFF
ENSORLT00000016541_Oryzias.     EFLLYDPDELQLQRNTDVHFQQELT--GCCSYRSTFKQVYAMVDLLLHAIVEWARMSALF
GSTENT00020031001_Tetraodon.    ELLRCDPDEVVVQNKIVAHLQQEQSGRARADKASTFSVMCRMADQTLFSIVEWARSCIFF
GSTENT00034373001_Tetraodon.    QLLEGEQDESQLCAKVVASLQREQANRGKHDRLNTFSIMCKMADQTLFGLVEWARNSSLF
SINFRUT00000132871_Takifugu.    ELLRCDPDELVVQNKIVAHLQQEQSGRARTDKASTFSVMCRMADQTLFSIVEWARSCIFF
                                ::   : :*  :  .    ::      .  .       :  *.*  : .:*:*** . .*

HIT000041571_Homo.          287 KELE---------------------------------------VADQMTLLQNCWSELLV 307
XM_520248_Pan.                  KELE---------------------------------------VADQMTLLQNCWSELLV
ENSPPYT00000022867_Pongo.       KELE---------------------------------------VADQMTLLQNCWSELLV
XM_001082881_Macaca.            KELE---------------------------------------VADQMTLLQNCWSELLV
AK134378_Mus.                   KELE---------------------------------------VADQMTLLQNCWSELLV
XM_001055033_Rattus.            KELE---------------------------------------VADQMTLLQNCWSELLV
XM_846937_Canis.                KELE---------------------------------------VADQMTLLQNCWSELLV
D13569_Bos.                     KELE---------------------------------------VADQMTLLQNCWSELLV
XM_001371666_Monodelphis.       KELE---------------------------------------VADQMKLLQNCWSELLV
AB002404_Gallus.                KELE---------------------------------------VGDQMKLLQNCWSELLV
AF198086_Danio.                 KELK---------------------------------------VGDQMRLLHNCWSELLL
BC124756_Danio.                 KELK---------------------------------------VDDQMVLLQSCWSELLV
AB016834_Oryzias.               KELR---------------------------------------VGDQMKLLHNCWSELLV
ENSORLT00000016541_Oryzias.     KQLQ---------------------------------------ISDQMKLLHHCWSELLA
GSTENT00020031001_Tetraodon.    KELR-CPNPLAEEMQRSLRPRASSFVGALTGCSCSQAHPLEQAVGDQMKLLHNCWSELLV
GSTENT00034373001_Tetraodon.    KELK---------------------------------------VEDQMVLLQSCWSELLV
SINFRUT00000132871_Takifugu.    KELRVSPDPSAS--SEPLRPLIDLFFLMFVG---ARLLAQQSEVGDQMKLLHNCWSELLV
                                *:*.                                       : *** **: ****** 

HIT000041571_Homo.          308 FDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLRAQELVLQLLALQLDRQE 367
XM_520248_Pan.                  FDHIYRQVQHGKEGSILLVTGQEVELTTVAAQAGSLLHSLVLRAQELVLQLLALQLDRQE
ENSPPYT00000022867_Pongo.       FDHIYRQVQHGKEGSILLVTGQEVELTTVAAQAGSLLHSLVLRAQELVLQLLALQLDRQE
XM_001082881_Macaca.            FDHIYRQVQHGKEGSILLVTGQEVELTTVAAQAGSLLHSLVLRAQELVLQLLALQLDRQE
AK134378_Mus.                   LDHIYRQVQYGKEDSILLVTGQEVELSTVAVQAGSLLHSLVLRAQELVLQLHALQLDRQE
XM_001055033_Rattus.            LDHIYRQVQYGKEDSILLVTGQEVELSTVAVQAGSLLHSLVLRAQELVLQLHALQLDRQE
XM_846937_Canis.                FDHIYRQIQHGKDGSILLVTGQEVEMSTVAAQAGSLLHSLVLRAQELVLQLHALQLDRQE
D13569_Bos.                     FDHIYRQIQHGKEGSILLVTGQEVELTTVAAQAGSLLHSLVLRAQELVLQLHALQLDRQE
XM_001371666_Monodelphis.       FDHIYRQIQHGKEGSILLVTGQEVDLATVAAQAGSLLHSLVLRAQELVRQLHSLQVDKQE
AB002404_Gallus.                FDHVYRQLQHGKEHSVLLVTGQEVDLSAVAAQAGSILHSLVLRAQELVLHLHSPQVDRQE
AF198086_Danio.                 LDHICRQVHHGRDGSLLLITGQEVELSAVL-DAGPPLSSMVERGQDLSRRLQLLQVDSRE
BC124756_Danio.                 LDHLCRQVAYGRDGSICLITGQQIEASTILSQAGVTLSSLVSRAQDLVTKLRSLQLDREE
AB016834_Oryzias.               LDHIFRQVQHGKEDSILLVTGQEVQLSSILSQGEATLCSLVQRGQELAARLRALQVDRRE
ENSORLT00000016541_Oryzias.     LDIISGQILYDRQASLLLIGDHEVELPCTDHPPGPSLFDLSQRGQALVEKLHILKVDHQE
GSTENT00020031001_Tetraodon.    LDHIFRQVQHGQEDSILLVTGQEVALSFILSQAEATLSALVQRGQELAAKLRLLQVDRRE
GSTENT00034373001_Tetraodon.    LDHLCRQVAYSKEGCIYLVSGQQIEVSTILTQAGATLSGLVSRTQDLVSKLKALQLDRQE
SINFRUT00000132871_Takifugu.    LDHIFRQVQHGQEDSILLVTGQEVALSFILAQAEATLSGLVQRGQELAGKLRVLQVDRRE
                                :* :  *: :.:: .: *: .:::  .         *  :  * * *  :*   ::* .*

HIT000041571_Homo.          368 FVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVR 427
XM_520248_Pan.                  FVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVR
ENSPPYT00000022867_Pongo.       FVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVR
XM_001082881_Macaca.            FVCLKFIILFSLDLKFLNNHTLVKEAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVR
AK134378_Mus.                   FVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVR
XM_001055033_Rattus.            FVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVR
XM_846937_Canis.                FVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVR
D13569_Bos.                     FVCLKFLILFSLDVKFLNNHSLVKEAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVR
XM_001371666_Monodelphis.       FVCLKFLILFSLDVKFLENHSLAKDAQEKANAALLDYTMCHYPHCGDKFRQLLLRLAEVR
AB002404_Gallus.                FVCLKFLILFSLDVKYLENHALAKDAQEKANAALLEYTVCHYPHCTDKFRQLLLRLTEVR
AF198086_Danio.                 MACLKFLILFNPNVKLLENPQFVESVQEQVNGALLEYTLFSYPQCVERFSQLILRLPELR
BC124756_Danio.                 FVCLKYLVLFNPDVKSVQNRRQVEQTQERVNKALMDHTMQTHPGHSDKFGQLLLRLPEVR
AB016834_Oryzias.               IACLKFLLLFNPNVKLLENQAFVEGVQEQVNGALLEYTLTTYPQFQEKFSQLVVRLPELR
ENSORLT00000016541_Oryzias.     LASIKYLILFNPAAKELEDPGFIEKVKLQVGGALLEYTRTACPQLPNRLAHLLEFLSELR
GSTENT00020031001_Tetraodon.    IACLKFLLLFNPNVKLLEDQAFVEGVQEQVNGALLEYTLSTYPQFQEKFSQLVVRLPELR
GSTENT00034373001_Tetraodon.    FVCLKYLVLFNPDVKSVQGRRQVEQTQERVNRALMEHTQQRHPRHSDKFGQLLLRLPEVR
SINFRUT00000132871_Takifugu.    IACLKFLLLFNPS-----------------------------------------------
                                :..:*:::**.                                                 

HIT000041571_Homo.          428 ALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT--- 461
XM_520248_Pan.                  ALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT---
ENSPPYT00000022867_Pongo.       ALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT---
XM_001082881_Macaca.            ALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT---
AK134378_Mus.                   ALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT---
XM_001055033_Rattus.            ALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT---
XM_846937_Canis.                ALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT---
D13569_Bos.                     ALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT---
XM_001371666_Monodelphis.       SLSMQAEEYLYHKHLGGEVPCNNLLIEMLHAKRT---
AB002404_Gallus.                ALSMQAEEYLYHKHLSGEVPCNNLLIEMLHAKRT---
AF198086_Danio.                 SLSAEAEDFLCYKHLCGEVPCNNLLIEMLHAKGSSAQ
BC124756_Danio.                 SISLQVEEYLYQRHLLGDLPCNSLLTEMLHAKHT---
AB016834_Oryzias.               SLSTQAEDYLCYMHLSGEVPCNNLLIEMLHAKRACV-
ENSORLT00000016541_Oryzias.     PLSCLAEEYLYCRHLRGEVPCNSLLDEMLHAKHNCP-
GSTENT00020031001_Tetraodon.    TLSTQAEDFLCYMHLSGEVPCNNLLIEMLHAKRAC--
GSTENT00034373001_Tetraodon.    SISLQVEEYLYQRHLLGDLPCNSLLTEMLHTKHS---
SINFRUT00000132871_Takifugu.    -------------------------------------