Alignment of gene family/group
Amino acid abbreviation [ Alignment of orthologs ]

"Homo.": Ortholog,   "Homo_": Paralog

(Alignable sequences only)
[View by Jalview] (requires Java)

HIT000040995_Homo.              ------------------------------------------------------------
HIT000045032_Homo_ [View]       ------------------------------------------------------------
HIT000306225_Homo_ [View]       ------------------------------------------------------------
ENSPTRT00000003734_Pan.         ------------------------------------------------------------
XR_024837_Pan_                  ------------------------------------------------------------
XR_023256_Pan_                  ------------------------------------------------------------
ENSPPYT00000019366_Pongo_       ------------------------------------------------------------
XM_001089796_Macaca.            MEN---------------------------------------------------------
XR_011678_Macaca_               ------------------------------------------------------------
AK144899_Mus.                   ------------------------------------------------------------
ENSMUST00000110185_Mus_         ------------------------------------------------------------
AK159673_Mus_                   ------------------------------------------------------------
ENSRNOT00000004519_Rattus.      ------------------------------------------------------------
XM_001061327_Rattus_            ------------------------------------------------------------
XM_001064906_Rattus_            ------------------------------------------------------------
XM_547510_Canis.                ------------------------------------------------------------
ENSCAFT00000027185_Canis_       ------------------------------------------------------------
ENSCAFT00000003068_Canis_       ------------------------------------------------------------
XM_001493317_Equus_             ------------------------------------------------------------
XM_001497663_Equus_             ------------------------------------------------------------
BC151398_Bos.                   ------------------------------------------------------------
ENSBTAT00000021660_Bos_         ------------------------------------------------------------
BC119857_Bos_                   ------------------------------------------------------------
XM_001376602_Monodelphis.       ------------------------------------------------------------
ENSMODT00000034227_Monodelphis_ ------------------------------------------------------------
XM_001367034_Monodelphis_       ------------------------------------------------------------
ENSGALT00000016725_Gallus_      ------------------------------------------------------------
XM_695024_Danio.                ------------------------------------------------------------
BC139665_Danio.                 ------------------------------------------------------------
ENSDART00000074802_Danio_       ------------------------------------------------------------
ENSORLT00000021166_Oryzias.     ------------------------------------------------------------
ENSORLT00000020354_Oryzias_     ------------------------------------------------------------
ENSORLT00000014664_Oryzias_     ------------------------------------------------------------
GSTENT00030235001_Tetraodon_    ------------------------------------------------------------
GSTENT00032293001_Tetraodon_    ------------------------------------------------------------
GSTENT00005617001_Tetraodon_    MVTGVFGGCASRWHPGCPLSLQELQRRARVRTLAGHRSSPRGPNRLQKVQIKDKLGLVEP
SINFRUT00000173110_Takifugu.    ------------------------------------------------------------
SINFRUT00000147037_Takifugu.    ------------------------------------------------------------
SINFRUT00000152743_Takifugu_    ------------------------------------------------------------
SINFRUT00000155477_Takifugu_    ------------------------------------------------------------
                                                                                            

HIT000040995_Homo.              ------------------------------------------------------------
HIT000045032_Homo_ [View]       ------------------------------------------------------------
HIT000306225_Homo_ [View]       ------------------------------------------------------------
ENSPTRT00000003734_Pan.         ------------------------------------------------------------
XR_024837_Pan_                  ------------------------------------------------------------
XR_023256_Pan_                  ------------------------------------------------------------
ENSPPYT00000019366_Pongo_       ------------------------------------------------------------
XM_001089796_Macaca.            --------------------QFWEFGERSRQEGARWA-----------------------
XR_011678_Macaca_               ------------------------------------------------------------
AK144899_Mus.                   ------------------------------------------------------------
ENSMUST00000110185_Mus_         ------------------------------------------------------------
AK159673_Mus_                   ------------------------------------------------------------
ENSRNOT00000004519_Rattus.      ------------------------------------------------------------
XM_001061327_Rattus_            ------------------------------------------------------------
XM_001064906_Rattus_            ------------------------------------------------------------
XM_547510_Canis.                -----------------------MSGSWVRTLGASGR-----------------------
ENSCAFT00000027185_Canis_       ------------------------------------------------------------
ENSCAFT00000003068_Canis_       ------------------------------------------------------------
XM_001493317_Equus_             ------------------------------------------------------------
XM_001497663_Equus_             --------------------------------------------------MASISTFQVA
BC151398_Bos.                   ------------------------------------------------------------
ENSBTAT00000021660_Bos_         ------------------------------------------------------------
BC119857_Bos_                   ------------------------------------------------------------
XM_001376602_Monodelphis.       -----------------MKIPGPDQACSVQTILAEKSSLMARDFPCDPYGGISLFLPNTT
ENSMODT00000034227_Monodelphis_ ------------------------------------------------------------
XM_001367034_Monodelphis_       ------------------------------------------------------------
ENSGALT00000016725_Gallus_      ------------------------------------------------------------
XM_695024_Danio.                ------------------------------------------------------------
BC139665_Danio.                 ------------------------------------------------------------
ENSDART00000074802_Danio_       ------------------------------------------------------------
ENSORLT00000021166_Oryzias.     ------------------------------------------------------------
ENSORLT00000020354_Oryzias_     ------------------------------------------------------------
ENSORLT00000014664_Oryzias_     ------------------------------------------------------------
GSTENT00030235001_Tetraodon_    ------------------------------------------------------------
GSTENT00032293001_Tetraodon_    ------------------------------------------------------------
GSTENT00005617001_Tetraodon_    LISGVVMKLGLGKASRRPVHPQDSSSLERSVIFAALTRGRPVPLPIVLYAAIFCSLNGFL
SINFRUT00000173110_Takifugu.    ------------------------------------------------------------
SINFRUT00000147037_Takifugu.    ------------------------------------------------------------
SINFRUT00000152743_Takifugu_    ------------------------------------------------------------
SINFRUT00000155477_Takifugu_    ------------------------------------------------------------
                                                                                            

HIT000040995_Homo.              ------------------------------------------------------------
HIT000045032_Homo_ [View]       ------------------------------------------------------------
HIT000306225_Homo_ [View]       ------------------------------------------------------------
ENSPTRT00000003734_Pan.         ------------------------------------------------------------
XR_024837_Pan_                  ------------------------------------------------------------
XR_023256_Pan_                  ------------------------------------------------------------
ENSPPYT00000019366_Pongo_       ------------------------------------------------------------
XM_001089796_Macaca.            ------------------------------------------------------------
XR_011678_Macaca_               ------------------------------------------------------------
AK144899_Mus.                   ------------------------------------------------------------
ENSMUST00000110185_Mus_         ------------------------------------------------------------
AK159673_Mus_                   ------------------------------------------------------------
ENSRNOT00000004519_Rattus.      ------------------------------------------------------------
XM_001061327_Rattus_            ------------------------------------------------------------
XM_001064906_Rattus_            ------------------------------------------------------------
XM_547510_Canis.                ------------------------------------------------------------
ENSCAFT00000027185_Canis_       ------------------------------------------------------------
ENSCAFT00000003068_Canis_       ------------------------------------------------------------
XM_001493317_Equus_             ------------------------------------------------------------
XM_001497663_Equus_             ITEAPGKRVTVISAQAGSWEEDERRRQTRGAAPAGPAEATAPRPGRTSPGRQTLPRPPQE
BC151398_Bos.                   ------------------------------------------------------------
ENSBTAT00000021660_Bos_         ------------------------------------------------------------
BC119857_Bos_                   ------------------------------------------------------------
XM_001376602_Monodelphis.       FQDKGVQDGLRPHSGQSRLMSSAVLSVSQGRTVWLGGSDWFPKPACPEVSNLYCYGRRHL
ENSMODT00000034227_Monodelphis_ ------------------------------------------------------------
XM_001367034_Monodelphis_       ------------------------------------------------------------
ENSGALT00000016725_Gallus_      ------------------------------------------------------------
XM_695024_Danio.                ------------------------------------------------------------
BC139665_Danio.                 ------------------------------------------------------------
ENSDART00000074802_Danio_       ------------------------------------------------------------
ENSORLT00000021166_Oryzias.     ------------------------------------------------------------
ENSORLT00000020354_Oryzias_     ------------------------------------------------------------
ENSORLT00000014664_Oryzias_     ------------------------------------------------------------
GSTENT00030235001_Tetraodon_    ------------------------------------------------------------
GSTENT00032293001_Tetraodon_    ------------------------------------------------------------
GSTENT00005617001_Tetraodon_    QGHHLLHCTSAEATGPPGARAAAGFLLFLVGMGINIHSDHVLRSLRRPGEVAYRIPRGGV
SINFRUT00000173110_Takifugu.    ------------------------------------------------------------
SINFRUT00000147037_Takifugu.    ------------------------------------------------------------
SINFRUT00000152743_Takifugu_    ------------------------------------------------------------
SINFRUT00000155477_Takifugu_    ------------------------------------------------------------
                                                                                            

HIT000040995_Homo.              ------------------------------------------------------------
HIT000045032_Homo_ [View]       ------------------------------------------------------------
HIT000306225_Homo_ [View]       -----------------------------------------ML-----------------
ENSPTRT00000003734_Pan.         ------------------------------------------------------------
XR_024837_Pan_                  ------------------------------------------------------------
XR_023256_Pan_                  -----------------------------------------ML-----------------
ENSPPYT00000019366_Pongo_       -----------------------------------------ML-----------------
XM_001089796_Macaca.            ------------------------------------------------------------
XR_011678_Macaca_               ------------------------------------------------------------
AK144899_Mus.                   ------------------------------------------------------------
ENSMUST00000110185_Mus_         ------------------------------------------------------------
AK159673_Mus_                   -----------------------------------------ML-----------------
ENSRNOT00000004519_Rattus.      ------------------------------------------------------------
XM_001061327_Rattus_            ------------------------------------------------------------
XM_001064906_Rattus_            -----------------------------------------ML-----------------
XM_547510_Canis.                ------------------------------------------------------------
ENSCAFT00000027185_Canis_       ------------------------------------------------------------
ENSCAFT00000003068_Canis_       -----------------------------------------ML-----------------
XM_001493317_Equus_             ------------------------------------------------------------
XM_001497663_Equus_             PGALAAQRLPLPLPQPRPAPARGSEPEPSLRLGEDHAAIAAML-----------------
BC151398_Bos.                   ------------------------------------------------------------
ENSBTAT00000021660_Bos_         ------------------------------------------------------------
BC119857_Bos_                   ------------------------------------------------------------
XM_001376602_Monodelphis.       ARSRQELGEGRNLRQWASGRLEIPDGINGHISGPDQVRLYNLSGLGPNPEPLLQVKGNRD
ENSMODT00000034227_Monodelphis_ ------------------------------------------------------------
XM_001367034_Monodelphis_       -----------------------------------------MLADVPRFSQIPPPPPPPI
ENSGALT00000016725_Gallus_      -----------------------------------------ML-----------------
XM_695024_Danio.                ------------------------------------------------------------
BC139665_Danio.                 ------------------------------------------------------------
ENSDART00000074802_Danio_       ------------------------------------------------------------
ENSORLT00000021166_Oryzias.     ------------------------------------------------------------
ENSORLT00000020354_Oryzias_     ------------------------------------------------------------
ENSORLT00000014664_Oryzias_     ------------------------------------------------------------
GSTENT00030235001_Tetraodon_    ------------------------------------------------------------
GSTENT00032293001_Tetraodon_    ------------------------------------------------------------
GSTENT00005617001_Tetraodon_    FELVSGANFLGEILEWAGYALATWSLPALAFAFFTACSIGPRAYHHHSGRMITGWRFGLR
SINFRUT00000173110_Takifugu.    ------------------------------------------------------------
SINFRUT00000147037_Takifugu.    ------------------------------------------------------------
SINFRUT00000152743_Takifugu_    ------------------------------------------------------------
SINFRUT00000155477_Takifugu_    -----------------------------------------MK-----------------
                                                                                            

HIT000040995_Homo.            1 -------------------------------------------------MMDSPFLELWQ 11
HIT000045032_Homo_ [View]       -----------------------------------------------------------M
HIT000306225_Homo_ [View]       ------------------PF------------------------------------LLAT
ENSPTRT00000003734_Pan.         -------------------------------------------------MMDSPFLELWQ
XR_024837_Pan_                  -----------------------------------------------------------M
XR_023256_Pan_                  ------------------PF------------------------------------LLAT
ENSPPYT00000019366_Pongo_       ------------------PF------------------------------------LLAT
XM_001089796_Macaca.            ---------------ERKAPYGQHAYTGPPQRVHPQS-FLPLASGKTGMMADSPFLELWQ
XR_011678_Macaca_               -----------------------------------------------------------M
AK144899_Mus.                   -------------------------------------------------MTSSPFLDPWP
ENSMUST00000110185_Mus_         -----------------------------------------------------------M
AK159673_Mus_                   ------------------PF------------------------------------LLAT
ENSRNOT00000004519_Rattus.      -------------------------------------------------MTSSPFLDPWP
XM_001061327_Rattus_            -----------------------------------------------------------M
XM_001064906_Rattus_            ------------------PF------------------------------------LLAT
XM_547510_Canis.                ---------------LETAARSRASCVLFGGRLQARSGRLRTARGRTGTMTHRPSLELWQ
ENSCAFT00000027185_Canis_       ---------------------------------------------------------PRM
ENSCAFT00000003068_Canis_       ------------------PF------------------------------------LLAT
XM_001493317_Equus_             ---------------------------------MLRLAGLAQVPRQVLISLVSSREPPRM
XM_001497663_Equus_             ------------------PF------------------------------------LLAT
BC151398_Bos.                   -------------------------------------------------MTESPFLELWQ
ENSBTAT00000021660_Bos_         -------------------------------------------------------EPPRM
BC119857_Bos_                   ------------------------------------------------------------
XM_001376602_Monodelphis.       REAPPPPSSPRLPACSGTSEKALAEGILTGSTSLPDSSHPPPGMKG---TTNLSTLALWH
ENSMODT00000034227_Monodelphis_ ------------------------------------------------------------
XM_001367034_Monodelphis_       SLQGQSRKTERNTGSPPQPFPAPSPPNQDPLSPAPILPNQDLGISPTEDDAAIAATMPSL
ENSGALT00000016725_Gallus_      ------------------PY------------------------------------VIAT
XM_695024_Danio.                ------------------------------------------------------------
BC139665_Danio.                 -----------------------------------------------------------M
ENSDART00000074802_Danio_       ------------------------------------------------MAFESWPAGGVR
ENSORLT00000021166_Oryzias.     ------------------------------------------------------------
ENSORLT00000020354_Oryzias_     ------------------------------------------------------------
ENSORLT00000014664_Oryzias_     ------------------------------------------------------------
GSTENT00030235001_Tetraodon_    ----------------------------------------------------------MS
GSTENT00032293001_Tetraodon_    ------------------------------------------------------------
GSTENT00005617001_Tetraodon_    AELPGPARAWIWCVRRDVDAALAGICTRLRRAERSGGSGADAQVLRQDAGVSVPSTSTIT
SINFRUT00000173110_Takifugu.    -----------------------------------------------------MAIWGAQ
SINFRUT00000147037_Takifugu.    ----------------------------------------------------------MS
SINFRUT00000152743_Takifugu_    ------------------------------------------------------------
SINFRUT00000155477_Takifugu_    ------------------------------------------------------------
                                                                                            

HIT000040995_Homo.           12 SKAVSIREQLGLGDRP--NDSYCYNSAKNSTVLQGVTFGGIPTVLLIDVSCFL-----FL 64
HIT000045032_Homo_ [View]       SASPDNLSTGGRLQNM--TVDECLQ--SRNTVLQGQPFGGVPTVLCLNIALWV-----LV
HIT000306225_Homo_ [View]       LGT------TALNNSN--PKDYCYSARIRSTVLQGLPFGGVPTVLALDFMCFL-----AL
ENSPTRT00000003734_Pan.         SKAVSIREQLGLGDRP--NDSYCYNSAKNSTVLQGVTFGGIPTVLLIDVSCFL-----FL
XR_024837_Pan_                  SASPDDLSTGRRLQNM--TVDECFQ--SRNTVLQGQPFGGIPTVLCLNIALWV-----LV
XR_023256_Pan_                  LGT------TALNNSN--PKDYCYSARIRSTVLQGLPFGGVPTVLALDFMCFL-----AL
ENSPPYT00000019366_Pongo_       LGT------TALNNSN--PKDYCYSARIRSTVLQGLPFGGVPTVLALDFMCFL-----AL
XM_001089796_Macaca.            SKAVSIREQLGLGDQP--NDSYCYNSAKNSTVLQGVTFGGIPTVLLIDVSCFL-----FL
XR_011678_Macaca_               SASPEELSTGGRLKNM--TVDECFQ--SRSTVLQGQPFGGVPTVLCLNIALWV-----LV
AK144899_Mus.                   SKAVFVRERLGLGERP--NDSYCYNSAKNSTVLQGVTFGGIPTVLLLDVSCFL-----FL
ENSMUST00000110185_Mus_         SAFPD--SMDQKFHNM--TVNECFQ--SRSTVLQGQPFGGIPTVLVLNIILWV-----FV
AK159673_Mus_                   LGT------AALNSSN--PKDYCYSARIRSTVLQGLPFGGVPTVLALDFMCFL-----AL
ENSRNOT00000004519_Rattus.      SKAVSIRERLGLGDRP--NDSYCYNSAKNSTVLQGVTFGGIPTVLLLDVGCFL-----VL
XM_001061327_Rattus_            TASPE--SMGQKFRNM--TANECFQ--SRSTVLQGQPFGGIPTVLLLNIILWV-----CV
XM_001064906_Rattus_            LGT------AALNSSN--PKDYCYSARIRSTVLQGLPFGGVPTVLALDFMCFL-----AL
XM_547510_Canis.                SKAVSMRERLGIGDQP--NDSYCYNSAKNSTVLQGITFGGIPTVLLIDVSCFL-----CL
ENSCAFT00000027185_Canis_       AVPLSNLNMVEKTRNI--T-DECFQ--SRSTVLQGQAFGGIPTVLILNIFLWV-----VI
ENSCAFT00000003068_Canis_       LGT------TALNNSN--PKDYCYSARIRSTVLQGLPFGGVPTVLALDFMCFL-----AL
XM_001493317_Equus_             AVSPGDLNAVEKTRNM--SAADCFH--SRNTVLQGQPFGGIPTVLFLNCILWV-----VI
XM_001497663_Equus_             LGT------TALNNSN--PKDYCYSARIRSTVLQGLPFGGVPTVLALDFMCFL-----AL
BC151398_Bos.                   SRAVAIPERLGIGDQP--NDSYCYNSAKNSTVLQGVTFGGIPTVLFIDVTCFL-----FL
ENSBTAT00000021660_Bos_         TVLPSSLNMVGKSRNF--TVDDCFS--SRNTVLKGQPFGGIPTVLFLNIILWV-----VI
BC119857_Bos_                   ------------------------------------------------------------
XM_001376602_Monodelphis.       SGVIRSRERLGVGDKP--IDSYCYSTANSSTVLQGVTFGGVPTVLLIDVSCFL-----FL
ENSMODT00000034227_Monodelphis_ --SNFLSSFSLLFHRS--SKESCLH--FRDSILMEYAFGGVPVVFALNVVFWL-----IA
XM_001367034_Monodelphis_       LGS------VVLNASE--PRDYCYSARIRSTVLQGLPFGGIPTVLALDFLCFL-----LL
ENSGALT00000016725_Gallus_      LGSAGSTCKASTCSNS--TKDYCYSARIRSTVLQGLPFGGVPTVLALDFMCFL-----AL
XM_695024_Danio.                ----MIATGSTNNTNG--TQDFCYSGRIRSTVLQGLPFGGVPTVLALDFMCFL-----VL
BC139665_Danio.                 SSWWGQLSESVNNSTVRLDNTSCFSS-TQSTVLKGVNFGGIPVVLLLDFTVFI-----LL
ENSDART00000074802_Danio_       PVEELDVRSFLMEENS--TAERCYRSHSRSSVLQGLPFGGVPTVLAINVVLWL-----IL
ENSORLT00000021166_Oryzias.     -------------------------STNQSTVLSGLNFGGIPLVLLLDFCVFI-----VL
ENSORLT00000020354_Oryzias_     ---VLGFPEARGEENS--TAERCFHSHSRSSVLQGLPFGGVPTVLAINVVLWM-----FL
ENSORLT00000014664_Oryzias_     -------------NET--SRDYCYSARIRSTVLQGLPFGGVPTVLALDFMCFL-----GL
GSTENT00030235001_Tetraodon_    SVWSEQWPLAPMNGTA--DSNSCFNG-TQSTVLNGDQFGGVPLVLLLDFIVFV-----VL
GSTENT00032293001_Tetraodon_    -------------ENS--TVERCYHSHSRSSVLQGLPFGGVPTVLIINVVLWM-----FL
GSTENT00005617001_Tetraodon_    MATWGQPCHNCSAQTG--SKDYCYSARIRSTVLQGLPFGGVPTVLALDFMCFLVLGLQVL
SINFRUT00000173110_Takifugu.    GCPDTESCPTQPPNSS--SRDFCYSARIRSTVLQGLPFGGVPTVLALDFMCFL-----VL
SINFRUT00000147037_Takifugu.    SVLSDQWPLGARNNTS--DSNSCYNN-SRSTVLNGDQFGGVPLVLLLNSSLFL-----VL
SINFRUT00000152743_Takifugu_    -------------ENS--TAERCYHSHSRSSVLQGLPFGGVPTVLIINVVLWM-----FL
SINFRUT00000155477_Takifugu_    ------------------------------------------------------------
                                                                                            

HIT000040995_Homo.           65 ILVFSIIRRRFWDYGRIALVSEAD--S------------------------ESRFQRLSS 98
HIT000045032_Homo_ [View]       LVVYSFLRKAAWDYGRLALLIHND--SLT---------------SLIYGE---QSEKTSP
HIT000306225_Homo_ [View]       LFLFSILRKVAWDYGRLALVTDAD--RLRR-QERDRVE-QEYVASAMHGDSHDRYERLTS
ENSPTRT00000003734_Pan.         ILVFSIIRRRFWDYGRIALVSEAD--S------------------------ESRFQRLSS
XR_024837_Pan_                  LVVYSFLRKAAWDYGRLALLIHND--SLT---------------SLIYGE---QSEKTSP
XR_023256_Pan_                  LFLFSILRKVAWDYGRLALVTDAD--RLRR-QERDRVE-QEYVIMRM-GGTGRREVRVGG
ENSPPYT00000019366_Pongo_       LFLFSILRKVAWDYGRLALVTDAD--RLRW-QERDRVE-QEYVASAMHGDSHDRYERLTS
XM_001089796_Macaca.            ILVFSIIRRRFWDYGRIALVSEAD--S------------------------ESRFQRLSS
XR_011678_Macaca_               LVVYSFLRKAAWDYGRLALLIHND--SLT---------------SLIYGE---QSEKTSP
AK144899_Mus.                   ILVFSIIRRRFWDYGRIALVSEAG--S------------------------EARFQRLSS
ENSMUST00000110185_Mus_         VLLYSFLRKAAWDYGRLALLIHND--SLT---------------SLIYGE---QSEKSSP
AK159673_Mus_                   LFLFSILRKVAWDYGRLALVTDAD--RLRR-QERERVE-QEYVASAMHGDSHDRYERLTS
ENSRNOT00000004519_Rattus.      ILVFSIIRRKFWDYGRIALVSEAG--S------------------------EARFRRLSS
XM_001061327_Rattus_            VLVYSFLRKAAWDYGRLALLIHND--SLT---------------SLIYGE---QSEKSSP
XM_001064906_Rattus_            LFLFSILRKVAWDYGRLALVTDAD--RLRR-QERERVE-QEYVASAMHGDSHDRYERLTS
XM_547510_Canis.                IFVFSIIRRKFWDYGRIALVSEAD--S------------------------ESRFQRLSS
ENSCAFT00000027185_Canis_       ILVYSFLRKAAWDYGRLALLIHND--SLT---------------SLIYGE---QSEKTSP
ENSCAFT00000003068_Canis_       LFLFSILRKVAWDYGRLALVTDAD--RRRRQQERERVE-QEYVASAMHGDSHDRYERLTS
XM_001493317_Equus_             ILVYSFLRKAAWDYGRLALLIHND--SLT---------------SLIYGE---QSEKTSP
XM_001497663_Equus_             LFLFSILRKVAWDYGRLALVTDAD--RRRR-QERDRVE-QEYVASAMHGDSHDRYERLTS
BC151398_Bos.                   IAAFSIIRRKFWDYGRIALVSEGN--S------------------------ESRFRRLSS
ENSBTAT00000021660_Bos_         VLVYSFLRKAAWDYGRLALLIHND--SLT---------------SLVYGE---QSEKTSP
BC119857_Bos_                   ------------------------------------------------------------
XM_001376602_Monodelphis.       IVVFSIIRRRFWDYGRIALVSEKD--S------------------------ESRYQRLSS
ENSMODT00000034227_Monodelphis_ IFIYAFLRKAAWDYGRLGLLADHNRTSLI---------------SMFFGE---QTEKISP
XM_001367034_Monodelphis_       LFLFSVLRKVAWDYGRLALVTDVD--RLRR-QQRDRVE-QEYMSSATQADSHDRYERLTS
ENSGALT00000016725_Gallus_      LFVFSILRKVAWDYGRLALVTDAD--RRRR-WQTEREE-REYIASALHSDNHDRYERLTS
XM_695024_Danio.                LCVFSFLRKVAWDYGRLALVSDAD--SVA---------------SAMQTPADSRYERLTS
BC139665_Danio.                 LSIFTLIRRKLWDYGRLALVAETD--VFG-------------------DGRKRRYSRLTS
ENSDART00000074802_Danio_       LLIFSCLRKAAWDYGRLALLMKND--SLT---------------SLFYGE-QSEKEKTPS
ENSORLT00000021166_Oryzias.     LVLFSIIREKFWDYGRLALVSDSD--GFN-------------------ESTHRRYGRMSS
ENSORLT00000020354_Oryzias_     LLIFSCLRKAAWDYGRLALLMEND--SLT---------------SLFYGE-PSEKEKTPS
ENSORLT00000014664_Oryzias_     LFLFSILRKLAWDYGRLALIAKDD--SESQRIETQKTEREAYSMSAVTSETSDRYERLAS
GSTENT00030235001_Tetraodon_    LFIFSIIRRNFWDYGRLALLADHE------------------------------------
GSTENT00032293001_Tetraodon_    LLIFSCLRKAAWDYGRLALLMEND--SLT---------------SLFYGE-ASEKEKSPS
GSTENT00005617001_Tetraodon_    LFVFSILRKVAWDYGRLALVTDAD--SVS---------------TAVHSETQDRYERLTS
SINFRUT00000173110_Takifugu.    LLVFSFLRKVAWDYGRLALVTDAD--SVG---------------SAATSDAPERYERLTS
SINFRUT00000147037_Takifugu.    LFIFTIIRRNFWDYGRLALLADHE------------------------------------
SINFRUT00000152743_Takifugu_    LLIFSCLRKAAWDYGRLALLMEND--SLT---------------SLFYGE-PSEKEKSPS
SINFRUT00000155477_Takifugu_    ------------------------------------------------------------
                                                                                            

HIT000040995_Homo.           99 TSSSGQQDFENELGCCPWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVVSFLSL 158
HIT000045032_Homo_ [View]       -SETSLEMERRDKGFCSWFFNSITMKDEDLINKCGDDARIYIVFQYHLIIFVLIICIPSL
HIT000306225_Homo_ [View]       -VSSSVDFDQRDNGFCSWLTAIFRIKDDEIRDKCGGDAVHYLSFQRHIIGLLVVVGVLSV
ENSPTRT00000003734_Pan.         TSSSGQQDFENELGCCPWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVVSFLSL
XR_024837_Pan_                  -SETSLEMERRDKGFCSWFFNSITMKDEDLINKCGDDARIYIVFQYHLIIFVLIICIPSL
XR_023256_Pan_                  -LGTPADSPLFPQGFCSWLTAIFRIKDDEIRDKCGGDAVHYLSFQRHIIGLLVVVGVLSV
ENSPPYT00000019366_Pongo_       -VSSSVDFDQRDNGFCSWLTAIFRIKDDEIRDKCGGDAVHYLSFQRHIIGLLVVVGVLSV
XM_001089796_Macaca.            TSSSGQQDFENELGCCPWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVVSFLSL
XR_011678_Macaca_               -SETSLEMERRDKGFCSWFFNSITMKDEDLINKCGDDARIYIVFQYHLIIFVLIICIPSL
AK144899_Mus.                   -SSSGQQDFENELGCCPWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVISFLSL
ENSMUST00000110185_Mus_         -SEVSLEAERRDRGFSSWFFNSLTMRDRDLINKCGDDARIYITFQYHLIIFVLILCIPSL
AK159673_Mus_                   -VSSSVDFDQRDNGFCSWLTAIFRIKDDEIRDKCGGDAVHYLSFQRHIIGLLVVVGVLSV
ENSRNOT00000004519_Rattus.      -SSSGQQDFESELGCCSWLSAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVVSFLSL
XM_001061327_Rattus_            -SEVYLEAERRDKGFSTWFFNSLTMRDRDLINKCGEDARIYIMFQYHLIIFVLILCIPSL
XM_001064906_Rattus_            -VSSSVDFDQRDNGFCSWLTAIFRIKDDEIRDKCGGDAVHYLSFQRHIIGLLVVVGVLSV
XM_547510_Canis.                SSSFGQQDFESELGCCPWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVVSCLSL
ENSCAFT00000027185_Canis_       -SDISLEMEHKDKGFYSWFFNTVTMKNEDLISKCGDDARTYIMFQYHLIIFVLILCIPSL
ENSCAFT00000003068_Canis_       -VSSSVDFDQRDNGFCSWLTAIFRIKDDEIRDKCGGDAVHYLSFQRHIIGLLVVVGVLSV
XM_001493317_Equus_             -SDISLEMEHKDKGFYSWFFNTITMKNEDLISKCGEDARIYITFQYHLIIFVLILCIPSL
XM_001497663_Equus_             -VSSSVDFDQRDNGFCSWLTAIFRIKDDEIRDKCGGDAVHYLSFQRHIIGLLVVVGVLSV
BC151398_Bos.                   -SSSGQQDFESEMGLCSWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVVSCLSL
ENSBTAT00000021660_Bos_         -SDISLEMEHRDKGFYSWFFNTITMKNEDLISRCGDDARIYIMFQYHLIIFILILCIPSL
BC119857_Bos_                   ------------------------------------------------------------
XM_001376602_Monodelphis.       -SSSGHHDYESDLGCCSWLTAVFRMQDEQIQEWCGDDAIHYLSFQRHIIFLLVVISFLSL
ENSMODT00000034227_Monodelphis_ -LEATLEEQGRDTGYFSWFFNTVLMKKEKLVRKCGDDAKIYLDFQIHLIFLFTFLCVPSL
XM_001367034_Monodelphis_       -VSSSVDFEQRDNGFCSWLTAIFRIKDEEILDKCGGDAVHYLTFQRHIIGLLAVAGVLSV
ENSGALT00000016725_Gallus_      -VSSSVDFDQRDNGFCSWLTAIFRIKDDEIRDKCGGDAVHYLSFQRHIIGLLVAVGVLSV
XM_695024_Danio.                -VSSSVDFDQRDNGLCSWLTAIFRIKDDEIREKCGEDAVHYLSFQRHIIGLLVVVGVLSV
BC139665_Danio.                 --SMSVEEPEYEKGCCSWLTFIVNMDETLVQERCGVDAVHYLPFQKHLVTLLLIICVLSV
ENSDART00000074802_Danio_       -DSSPSDSETKDMGFCSWLTSLYHMKDEEIRSKCGIDAVTYLSFQRHIILLMMVVCLLSL
ENSORLT00000021166_Oryzias.     -AASNTEDFGYESGFCSWLPYIVRMDEEKIKEKCGIDAVHYLSFQRHLIILLVVITVTSL
ENSORLT00000020354_Oryzias_     -ETSPSDSDTKDMGFCSWLLSLYYMKDGEIRSKCGIDAVTYLSFQRHIILLMTVVSLLSL
ENSORLT00000014664_Oryzias_     -VSSSLDFDQTDHGFCSWLTAVFRIKEDELREKCGEDAIHYLSFQRHIIGLLVVVGVLSV
GSTENT00030235001_Tetraodon_    -------------------------GEEKVKSKCGVDAVHYLSFQRHLLILLMVLTVSSL
GSTENT00032293001_Tetraodon_    -ESSPSDSETKDMGFCSWLSSLYHMKDEEIRSKCGIDAVTYLSFQRHIILLMTVVCLLSL
GSTENT00005617001_Tetraodon_    -VSSSVDLEQRDNGFCSWLTAIFRIKDEEIREKCGEDAVHYLSFQRHIIGLLVVIGVLSV
SINFRUT00000173110_Takifugu.    -VSSSVDIDQRDTGFCSWLTAIFRIKEDEIREKCGEDAVHYLSFQRHIIGLLVVVGVLSV
SINFRUT00000147037_Takifugu.    -------------------------GEQKIKARCGVDAVHYLSFQRHLLILLGLITICSI
SINFRUT00000152743_Takifugu_    -ESSPSDSEMKDMGFCSWLSSLYHMKDEEIRSKCGIDAVTYLSFQRHVILLMTVFCLLSL
SINFRUT00000155477_Takifugu_    --SSSFDEKQQQQ-----------------------------------------------
                                                                                            

HIT000040995_Homo.          159 CVILPVNLSGDLL------------DKDPYSFGRTTIANLQTD--NDLL-----WLHTIF 199
HIT000045032_Homo_ [View]       GIILPINYTGSVL------------DWS-SHFARTTIVNVSTE--SKLL-----WLHSLL
HIT000306225_Homo_ [View]       GIVLPVNFSGDLL------------ENNAYSFGRTTIANLKSG--NNLL-----WLHTSF
ENSPTRT00000003734_Pan.         CVILPVNLSGDLL------------DKDPYSFGRTTIANLQTD--NDLL-----WLHTIF
XR_024837_Pan_                  GIILPHHYTGSVL------------DWS-SHFARTTIVNVSTEAWSPLT-----SLVSAT
XR_023256_Pan_                  GIVLPVNFSGDLL------------ENNAYSFGRTTIANLKSG--NNLL-----WLHTSF
ENSPPYT00000019366_Pongo_       GIVLPVNFSGDLL------------ENNAYSFGRTTIANLKSG--NNLL-----WLHTSF
XM_001089796_Macaca.            CVILPVNLSGDLL------------DKDPYSFGRTTIANLQTD--NDLI-----WLHTIF
XR_011678_Macaca_               GIILPINYTGSVL------------DWS-SHFARTTIVNVSTE--VPDLKLPFHWLGVLI
AK144899_Mus.                   CVILPVNLSGDLL------------GKDPYSFGRTTIANLQTD--NDLL-----WLHTVF
ENSMUST00000110185_Mus_         GIILPVNYIGTVL------------DWN-SHFGRTTIVNVSTE--SKFL-----WLHSLF
AK159673_Mus_                   GIVLPVNFSGDLL------------ENNAYSFGRTTIANLKSG--NNLL-----WLHTSF
ENSRNOT00000004519_Rattus.      CVILPVNLSGDLL------------DKDPYSFGRTTIANLQTD--NDLL-----WLHTVF
XM_001061327_Rattus_            GIILPVNYIGSAL------------DWS-SHFGRTTIVNVSTE--SQFL-----WLHSIF
XM_001064906_Rattus_            GIVLPVNFSGDLL------------ENNAYSFGRTTIANLKSG--NNLL-----WLHTSF
XM_547510_Canis.                CVILPVNLSGDLL------------DKDPYSFGRTTIANLQTD--NDLL-----WLHTIF
ENSCAFT00000027185_Canis_       GIILPINYTGTVL------------DWS-SHFGRTTIVNVSIE--SKVL-----WLHSCF
ENSCAFT00000003068_Canis_       GIVLPVNFSGDLL------------ENNAYSFGRTTIANLKSG--NNLL-----WLHTSF
XM_001493317_Equus_             GIILPINYSGTVL------------EPN-SHFGRTTIVNVSTE--SNLL-----WLHSCF
XM_001497663_Equus_             GIVLPVNFSGDLL------------ENNAYSFGRTTIANLKSG--NNLL-----WLHTSF
BC151398_Bos.                   CVILPVNLSGDLL------------DKDPYSFGRTTIANLQTD--NNLL-----WLHTVF
ENSBTAT00000021660_Bos_         GIILPINYTGDVL------------DRD-SHFGRTTIVNVSTE--SKFL-----WLHSIF
BC119857_Bos_                   ------------------------------------------------------------
XM_001376602_Monodelphis.       CIILPVNLSGDLL------------DKDPYSFGRTTIANLQVG--NNLL-----WLHTIF
ENSMODT00000034227_Monodelphis_ GVILPINYSGEIL------------DPD-TNFGSFTIVNVSKN--YNIL-----WVHSLF
XM_001367034_Monodelphis_       GIVLPVNFSGNLL------------ENNPYSFGRTTIANLDSS--NNRL-----WLHTSF
ENSGALT00000016725_Gallus_      GIVLPVNFSGDLL------------ENNAYSFGRTTIANLNSG--NNLL-----WLHTSF
XM_695024_Danio.                GIVLPVNFSGDQL-----VETGNFENNNAYSFGRTTVVNLKSG--NHLL-----WLHTIF
BC139665_Danio.                 SIILPVNLSGDLL------------GTDPYNFGRTTIGNLQHD--DKLL-----WLHTVF
ENSDART00000074802_Danio_       TIILPVNLSGNLL----------------ENFGRTTVVNVPAQ--NIFL-----WLHSIF
ENSORLT00000021166_Oryzias.     AIIMPVNMSGDLL------------KNDPQNFGRTTIGNLKTG--NNLL-----WLHTVF
ENSORLT00000020354_Oryzias_     AVILPVNFSGNLL------------GDSPQNFGRTTLANVSAK--DNFL-----WLHSIF
ENSORLT00000014664_Oryzias_     GIILPVNFSGNLL------------ENNAYSFGRTTIANLDVG--NKLL-----WLHTTF
GSTENT00030235001_Tetraodon_    GIILPVNLSGDLL------------DNE---FGRTTIGNIEIG--NNLL-----WLHTVF
GSTENT00032293001_Tetraodon_    TVILPVNFSGKLQ------------GDSPENFGRTTLANVGAE--DNFL-----WLHSIF
GSTENT00005617001_Tetraodon_    GIILPINFSGDLLGETPLRLCSRRRENNAYSFGRTTIANLKSG--TNLL-----WLHTSF
SINFRUT00000173110_Takifugu.    GIILPVNFSGNLL------------ENNAYSFGRTTIANLDTD--NALL-----WLHTTF
SINFRUT00000147037_Takifugu.    GIILPVNMSGDLL------------DNE---FGRTTIGNVEIG--NNLL-----WLHTVF
SINFRUT00000152743_Takifugu_    TVILPVNFSGKLQ------------GDSPENFGRTTLANVSAE--DNFL-----WLHSIF
SINFRUT00000155477_Takifugu_    ----PI------------------------------------------------------
                                                                                            

HIT000040995_Homo.          200 AVIYLFLTVGFMRHHTQSIKYKEE-NL------------------------VRRTLFITG 234
HIT000045032_Homo_ [View]       SFFYFITNFMFMAHHCLGFAPRNS-QK------------------------VTRTLMITY
HIT000306225_Homo_ [View]       AFLYLLLTVYSMRRHTSKMRYKED-DL------------------------VKRTLFING
ENSPTRT00000003734_Pan.         AVIYLFLTVGFMRHHTQSIKYKEE-NL------------------------VRRTLFITG
XR_024837_Pan_                  SAFLLVTRSLFQD----PFLQHNY-QT------------------------VTRTLMITY
XR_023256_Pan_                  AFLYLLLTVYSMRRHTSKMRYKED-DL------------------------VKRTLFING
ENSPPYT00000019366_Pongo_       AFLYLLLTVYSMRRHTSKMRYKED-DL------------------------VKRTLFING
XM_001089796_Macaca.            AVIYLFLTVGFMRHHTQSIKYKEE-NL------------------------VRRTLFITG
XR_011678_Macaca_               EHCFPVTNRLQSAAHCWPEVPTSSQQK------------------------VTRTLMITY
AK144899_Mus.                   SVIYLFLTVGFMWHHTRSIRYKEE-SL------------------------VRQTLFITG
ENSMUST00000110185_Mus_         AFLYFLINLAFMGHHCLGFVPKKS-LH------------------------FTRTLMITY
AK159673_Mus_                   AFLYLLLTVYSMRRHTSKMRYKED-DL------------------------VKRTLFING
ENSRNOT00000004519_Rattus.      SVIYLFLTVGFMWHHTRSIRYKEE-SL------------------------VRQTLFITG
XM_001061327_Rattus_            AFMYFLTNFAFMGHHCLGFVPKKN-LH------------------------FTRTLMITY
XM_001064906_Rattus_            AFLYLLLTVYSMRRHTSKMRYKED-DL------------------------VKRTLFING
XM_547510_Canis.                AVLYLILTVGFMRHHTQSILYKEE-SL------------------------VRRTLFITG
ENSCAFT00000027185_Canis_       SFLYFLLNLVFMAHHCLGFVPKRS-YR------------------------VTRTLMITY
ENSCAFT00000003068_Canis_       AFLYLLLTVYSMRRHTSKMRYKED-DL------------------------VKRTLFING
XM_001493317_Equus_             SFLYFLTNFIFMTHHCLGFVPKKR-HQ------------------------VTRTLMITY
XM_001497663_Equus_             AFLYLLLTVYSMRRHTSKMRYKED-DL------------------------VKRTLFING
BC151398_Bos.                   AILYLILTVVFMRHHTQSIKYKEE-SL------------------------VRRTLFVTG
ENSBTAT00000021660_Bos_         AFLYFITNLLFMTHHCLGFVPRKS-YA------------------------VTRTLMITY
BC119857_Bos_                   ------------------------------------------------------------
XM_001376602_Monodelphis.       AVIYLLLTIGFMRHHTQSIKYKKE-NL------------------------VRRTLFITG
ENSMODT00000034227_Monodelphis_ SFFYFLITFAFMTHHSQQIKPKE--SM------------------------MTKTLMITY
XM_001367034_Monodelphis_       AFLYLLLTVYTMRRHTSKLRYKED-DL------------------------VKRTLFING
ENSGALT00000016725_Gallus_      AFLYLLLTVYSMRRHTSKMRYKED-DL------------------------VKRTLFING
XM_695024_Danio.                AFFYLLLTVYSMRRHTSKMHYKED-DL------------------------VKRTLFISG
BC139665_Danio.                 AVLYLMITVFLLRRYTSKMKGTKR-EI------------------------VRNTLFVRP
ENSDART00000074802_Danio_       ALLYFVITVLCMAHHSSRLEYRED-EK------------------------VARTLMITS
ENSORLT00000021166_Oryzias.     AVIYLALTVVMLRVHTSQMKGLRK-ET------------------------ARNTLFVSP
ENSORLT00000020354_Oryzias_     ALVYFIITMLCMAHHAIRLEYRED-EK------------------------VARTLMITS
ENSORLT00000014664_Oryzias_     AFLYLLLTVFSMRRHTSKMHYKEN-DL------------------------VKRTLFING
GSTENT00030235001_Tetraodon_    AVVYLILTVVVLRRHTSQMKGMPR-ET------------------------TRNTLFVCS
GSTENT00032293001_Tetraodon_    ALVYFIITLLCMAHHSVRLEYRED-ER------------------------VARTLMITS
GSTENT00005617001_Tetraodon_    AFMYLLLTVYSMRRHTSKMHYKED-DLVGRGDAGMEQGCSSELGAQLPVFQVKRTLFING
SINFRUT00000173110_Takifugu.    AFLYLLLTVYSMRRHTSKMHYKED-DL------------------------VKRTLFVNE
SINFRUT00000147037_Takifugu.    AVVYLILTVILLRRHTSQMKGIPR-ET------------------------TRNTLFVCS
SINFRUT00000152743_Takifugu_    AMVYFIITLLCMAHHSARLEYRED-ER------------------------VARTLMITS
SINFRUT00000155477_Takifugu_    ---------------TSLLGQSED-G----------------------------------
                                                                                            

HIT000040995_Homo.          235 LPRDARK-ETVESHFRDAYPTCEVVDVQLCYNVAKLIYLCKEKKKTEKSLT-------YY 286
HIT000045032_Homo_ [View]       VPKDIEDPELIIKHFHEAYPGSVVTRVHFCYDVRNLIDLDDQRRHAMRGRL-------FY
HIT000306225_Homo_ [View]       ISKYAES-EKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKL-------YF
ENSPTRT00000003734_Pan.         LPRDARK-ETVESHFRDAYPTCEVVDVQLCYNVAKLIYLCKEKNKTEKSLT-------YY
XR_024837_Pan_                  VPKDIEDPELIIKHFHEAYPGSVVTRVHFCYDVRNLIDLDDQRRHAMRGRL-------FY
XR_023256_Pan_                  ISKYAES-EKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKL-------YF
ENSPPYT00000019366_Pongo_       ISKYAES-EKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKL-------YF
XM_001089796_Macaca.            LPRDARK-ETVESHFRDAYPTCEVVDVQLCYNVAKLIYLCKERKKTEKSLT-------YY
XR_011678_Macaca_               VPKDIEDPEIIIKHFHEAYPGSVVTRVHFCYDVRNLIDLDDQRRHAMRGRL-------FY
AK144899_Mus.                   LPREARK-ETVESHFRDAYPTCEVVDVQLCYSVAKLIYLCKERKKTEKSLT-------YY
ENSMUST00000110185_Mus_         VPTEIQDPEIISKHFHEAYPGCVVTRVHFCYDVRNLIDLDDQRRHAMRGRL-------YY
AK159673_Mus_                   ISKYAES-EKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKL-------YF
ENSRNOT00000004519_Rattus.      LPREARK-ETVESHFRDAYPTCEVVDVQLCYSVAKLINLCKERKKTEKSLT-------YY
XM_001061327_Rattus_            VPTEIQDPETISKHFHEAYPGCVVTRVHFCYDVRNLIDLDDQRRHAMRGRL-------YY
XM_001064906_Rattus_            ISKYAES-EKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERYRVGDGEV-------YR
XM_547510_Canis.                FPKDTKK-EAVESHFRDAYPTCEVVDVQLCYNVARLMYLCKERKKAEKSLT-------YY
ENSCAFT00000027185_Canis_       VPKDIQDPEIIIKHFHEAYPGCVVTRVHFCYDVRNLIELDDQRRHAMRGRL-------YY
ENSCAFT00000003068_Canis_       ISKYAES-EKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKL-------YF
XM_001493317_Equus_             VPTDIEDPEIIIKHFHEAYPGCVVTRVHFCYDVRTLIELDDQRRHAMRG-L-------YY
XM_001497663_Equus_             ISKYAES-EKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKL-------YF
BC151398_Bos.                   LPRHAKK-ETVESHFRDAYPTCEVVEVQLCYDVAKLIYLCKERKKTEKSLT-------YY
ENSBTAT00000021660_Bos_         VPTDIQDPEIIIKHFHEAYPGCVVTRVHFCYDVRTLIDLDDQRRHAMRGRL-------YY
BC119857_Bos_                   ------------------------------------------------------------
XM_001376602_Monodelphis.       LPKNTRK-EVLESHFRDAYPTCTVVEVQLCYDVAKLIYLCNERKKAEKSLN-------YY
ENSMODT00000034227_Monodelphis_ IPKEISDPEIIMKHFHEAYPTCKVVGVYFCYDLQKLIELDNQRQYAMKGRL-------FY
XM_001367034_Monodelphis_       ISKYAES-ENIKKHFEEAYPNCTVLEARPCYNVAKLMSLEDQRKEAERGRI-------YF
ENSGALT00000016725_Gallus_      ISKYAEP-EKIKKHFEEAYANCTVLEARPCYDVARLMFLDAERRKAERGRI-------YF
XM_695024_Danio.                IAKYAEE-SEIKQHFEKAYENCVVLDARICYNVAKLMSLESERKKAERSKK-------FY
BC139665_Danio.                 IPRTSTD-DSIKTHFMEAHPSCHVTSVNLCYDVAKLIDVNKNRKRAEKNLR-------HY
ENSDART00000074802_Danio_       IPREISDPGLITKHLHEAYPSCTVTDIHFCFNVQKLMKLDSERRKAMKGRL-------YF
ENSORLT00000021166_Oryzias.     VPKTATE-EDVKAHFVEAYPTCEVCAVTLGYDVARLMHLDKERLRAGKNLR-------YY
ENSORLT00000020354_Oryzias_     IPREICDPGLITKHFHEAYPSCTVTDNRFCFDVHKLIKLDLERRKAMKGRL-------YF
ENSORLT00000014664_Oryzias_     ISKQGEE-REIKQHFESAYSNCTVLETRICYDVAKLMQLNSERKKAERSKK-------YF
GSTENT00030235001_Tetraodon_    VPKAATE-EDIKSHFKEAYPTCQVRTVTLVYDVAKLMYLDKERIRAEKNLQ-------YY
GSTENT00032293001_Tetraodon_    IPREISDPGLITKHFHEAYPSCTVTDIRFGFDVHNLMRLDLERRKAMKGRL-------YF
GSTENT00005617001_Tetraodon_    VSKYAEE-SQIKQHFQQAYQNCVVLEARICYNVAKLMALNAERYQQEEEASSSGGASPVF
SINFRUT00000173110_Takifugu.    ISKYAEE-SEIKQHFENAYENCVVLEARICYDVAKLMNLNSERKKAERSKK-------FF
SINFRUT00000147037_Takifugu.    VPKMATE-EDIKTHFREAYPSCQVCSVTLVYNVTKLMYHDKERIRAEKNLQ-------YY
SINFRUT00000152743_Takifugu_    IPREISDPGLITKHFHEAYPSCTVTDIRFGFDVHKLMRLDSERRKAMKGRL-------YF
SINFRUT00000155477_Takifugu_    ------------------------------------------------------------
                                                                                            

HIT000040995_Homo.          287 TNLQVKTGQRTL------INPKPC--GQFCCC--EVLGCE-WEDAISYYTRMK------- 328
HIT000045032_Homo_ [View]       TAKAKKTG-KVM------IRIHPC--ARLCFC--KCWTCFKEVDAEQYYSELE-------
HIT000306225_Homo_ [View]       TNLQSKENMPTM------INPKPC--GHLCCC--VVRGCE-QVEAIEYYTKLE-------
ENSPTRT00000003734_Pan.         TNLQVKTGQRTL------INPKPC--GQFCCC--EVLGCE-WEDAISYYTRMK-------
XR_024837_Pan_                  TAKAKKTG-KVM------IRIHPC--ARLCFC--KCWTCFKEVDAEQYYSELE-------
XR_023256_Pan_                  TNLQSKENVPTM------INPKPC--GHLCCC--VVRGCE-QVEAIEYYTKLE-------
ENSPPYT00000019366_Pongo_       TNLQSKENVPTM------INPKPC--GHLCCC--VVRGCE-QVEAIEYYTKLE-------
XM_001089796_Macaca.            TNLQVKTGQRTL------INPKPC--GQFCCC--EVLGCE-WEDAISYYTRMK-------
XR_011678_Macaca_               TAKAKKTG-KVM------IRIHPC--ARLCFC--KCWTCFKEVDAEQYYSELE-------
AK144899_Mus.                   TNLQAKTGRRTL------INPKPC--GQFCCC--EVQGCE-REDAISYYTRMN-------
ENSMUST00000110185_Mus_         TAKAKKTG-KVM------IKTHPC--SRLCFC--KCWTCFKEVDAEQYYSELE-------
AK159673_Mus_                   TNLQSKENVPAM------INPKPC--GHLCCC--VVRGCE-QVEAIEYYTKLE-------
ENSRNOT00000004519_Rattus.      TNLQVKTGRRTL------INPKPC--GQFCCC--EVQGCE-REDAISYYTRMN-------
XM_001061327_Rattus_            TAKAKKTG-KVM------IKVHPC--SHLCFC--KCWTCFKEVDAEQYYSELE-------
XM_001064906_Rattus_            SENETKPNKPGLTCRREHILCEPCFRVYMCTC--VPWPCPLQVEAIEYYTKLE-------
XM_547510_Canis.                TNLQAKTGQWTL------INPKTC--GQFCCC--EVPGCE-WEDAISYYTRLK-------
ENSCAFT00000027185_Canis_       TAKAKKSG-KVM------IKTHPC--SRLCFC--KCWTCFKEVDAEQYYSELE-------
ENSCAFT00000003068_Canis_       TNLQSKENVPTM------INPKPC--GHLCCC--VVRGCE-QVEAIEYYTKLE-------
XM_001493317_Equus_             TAKAKKRG-KVM------IKVHPC--SRVCFC--KCWTCFKEVDAEQYYSELE-------
XM_001497663_Equus_             TNLQSKENVPTM------INPKPC--GHLCCC--VVRGCE-QVEAIEYYTKLE-------
BC151398_Bos.                   TNLQVKTGQRTF------INPKPC--GQFCCC--EVRGCE-WEDAISYYTRMK-------
ENSBTAT00000021660_Bos_         TAKAKKKG-KVM------IKVHPC--SRLCFC--RCWACFKEVDAEQYYSELE-------
BC119857_Bos_                   -----------M------INPKPC--GHLCCC--VVRGCE-QVEAIEYYTKLE-------
XM_001376602_Monodelphis.       TNLQTKTGERTL------INPKPC--GQFCFC--EIQGCE-KEDAITYYARMK-------
ENSMODT00000034227_Monodelphis_ NLYHQTKG-KKM------IRVHPC--SCICFC--HFCKCFKEVDAEQYYSELE-------
XM_001367034_Monodelphis_       SNLRARENTPTM------INPKPC--GHLCCC--VVRGCE-EVEAIQYYTELE-------
ENSGALT00000016725_Gallus_      TNLQSKENTPSM------INPKPC--GHLCCC--VIRGCE-EVEAIEYYTKLE-------
XM_695024_Danio.                TDLMSREHIPTM------INPKPC--GHLCCC--IIKGCE-QEEAVNYYTKLE-------
BC139665_Danio.                 NRILQQLGRREL------INPRPC--SHLCCCCQRCQGCE-EVDAIEFYSSQE-------
ENSDART00000074802_Danio_       TTKAQKNG-RIM------IKTHPC--AQIFCC--DICGFE-KVDAEQYYSELE-------
ENSORLT00000021166_Oryzias.     ERVLDKTGQREL------INPRLC--GHICCC----SGCV-KVDAIEYYCGKE-------
ENSORLT00000020354_Oryzias_     TTKAQKEG-KIM------IKTHLC--AHIFGC--DICGFE-RVDAEQYYSELE-------
ENSORLT00000014664_Oryzias_     IDLDKNASEPSK------VNPKPC--GHLCCC--AIKGCE-QENAVSYYTNLE-------
GSTENT00030235001_Tetraodon_    ERILNSTGTRKM------IDPRVC--SHLCCC----TRTE-KVDAIEYYSDKE-------
GSTENT00032293001_Tetraodon_    ATKAQKDG-KIL------IKTHPC--AQIFCC--DICGFE-KVDAEQYYSELE-------
GSTENT00005617001_Tetraodon_    CSPQEEGGAQQE------VLHRPD-----------------GQGARPHHDQPQALRTPLL
SINFRUT00000173110_Takifugu.    IDLQAKEHVTTM------MNPKPC--GHLCCC--VIKGCE-QEEAVSYYTKLE-------
SINFRUT00000147037_Takifugu.    ERILNNTGTRNM------IDPRVC--SHLCCC----TNTK-KVDAIEYYSNKE-------
SINFRUT00000152743_Takifugu_    ATKAQKDG-KIL------IKTHPC--AQIFCC--DICGFE-KVDAEQYYSELE-------
SINFRUT00000155477_Takifugu_    SDIAKGKSTAWR------TFEQP----------------E-EEEAVSFYTRRE-------
                                                     .                      *  .:   :       

HIT000040995_Homo.          329 ------------DRLLERITEEERHVQD-------------------------------- 344
HIT000045032_Homo_ [View]       ------------EQLTDEFNAELNRVPL--------------------------------
HIT000306225_Homo_ [View]       ------------QKLKEDYKREKEKVNE--------------------------------
ENSPTRT00000003734_Pan.         ------------DRLLERITEEERHVQD--------------------------------
XR_024837_Pan_                  ------------EQLTDEFNAELNRVPL--------------------------------
XR_023256_Pan_                  ------------QKLKEDYKREKEKVNE--------------------------------
ENSPPYT00000019366_Pongo_       ------------QKLKEDYKREKEKVNE--------------------------------
XM_001089796_Macaca.            ------------DRLLERITEEECHVQD--------------------------------
XR_011678_Macaca_               ------------EQLTDEFNAELNRVPL--------------------------------
AK144899_Mus.                   ------------DSLLERITAEESRVQD--------------------------------
ENSMUST00000110185_Mus_         ------------EQLTDEFNAELNRVQL--------------------------------
AK159673_Mus_                   ------------QRLKEDYRREKEKVNE--------------------------------
ENSRNOT00000004519_Rattus.      ------------DSLTERITAEECRVQD--------------------------------
XM_001061327_Rattus_            ------------EQLTDEFNAELNRVQL--------------------------------
XM_001064906_Rattus_            ------------QRLKEDYRREKEKVNE--------------------------------
XM_547510_Canis.                ------------DRLMERIAEEECRVQE--------------------------------
ENSCAFT00000027185_Canis_       ------------EQLTDEFNAELNRVRL--------------------------------
ENSCAFT00000003068_Canis_       ------------QKLKEDYKREKEKVNE--------------------------------
XM_001493317_Equus_             ------------EQLTDEFNAELNRVRL--------------------------------
XM_001497663_Equus_             ------------QKLKEDYKREKEKVNE--------------------------------
BC151398_Bos.                   ------------DGLMERITEEECRVQD--------------------------------
ENSBTAT00000021660_Bos_         ------------EQLTDEFNAELNRARL--------------------------------
BC119857_Bos_                   ------------QKLKEDYKREKEKVNE--------------------------------
XM_001376602_Monodelphis.       ------------DRLLQRLSQEEHTVQD--------------------------------
ENSMODT00000034227_Monodelphis_ ------------ERLTDEFNAERSQVYQ--------------------------------
XM_001367034_Monodelphis_       ------------QKLKEEYKQEQEKVNQ--------------------------------
ENSGALT00000016725_Gallus_      ------------EKLKDDYKREKEKVNE--------------------------------
XM_695024_Danio.                ------------AKLKEEYRKEREKVNT--------------------------------
BC139665_Danio.                 ------------AALHEE-EVRLKQGEL--------------------------------
ENSDART00000074802_Danio_       ------------EKLTDEFNAEKNWISM--------------------------------
ENSORLT00000021166_Oryzias.     ------------KFLLEEVRQEAEIVPQ--------------------------------
ENSORLT00000020354_Oryzias_     ------------EKRTDEFNAEKSRISL--------------------------------
ENSORLT00000014664_Oryzias_     ------------AEIRQQYRTEREKVNK--------------------------------
GSTENT00030235001_Tetraodon_    ------------KKLQEDVKKQVEMVPN--------------------------------
GSTENT00032293001_Tetraodon_    ------------EKWTDEFNAEKNRVSM--------------------------------
GSTENT00005617001_Tetraodon_    LRPGRLRGGGGGELLHQEGGETEGGVQEGEGEGPQQASGHGLRHLPERGHHRPDPEGLQR
SINFRUT00000173110_Takifugu.    ------------AKLKDEYRKEKEKVNK--------------------------------
SINFRUT00000147037_Takifugu.    ------------KELQMDVNNQLKMVPQ--------------------------------
SINFRUT00000152743_Takifugu_    ------------EKWTDEFNAEKNRVSM--------------------------------
SINFRUT00000155477_Takifugu_    ------------VKLKEEYRKEKEKVHT--------------------------------
                                                                                            

HIT000040995_Homo.          345 -------QPLGMAFVTFQEKSMATYILKDFNACKCQS---------------LQCKGEPQ 382
HIT000045032_Homo_ [View]       -------KRLDLIFVTFQDSRMAKRVRKDYKY--------------------VQCGVQPQ
HIT000306225_Homo_ [View]       -------KPLGMAFVTFHNETITAIILKDFNVCKCQG---------------CTCRGEPR
ENSPTRT00000003734_Pan.         -------QPLGMAFVTFQEKSMATYILKDFNACKCQS---------------LQCKGEPQ
XR_024837_Pan_                  -------KRLDLIFVTFQDSRMAKRVRKDYKY--------------------VQCGVQPQ
XR_023256_Pan_                  -------KPLGMAFVTFHNETITAIILKDFNVCKCQG---------------CTCRGEPR
ENSPPYT00000019366_Pongo_       -------KPLGMAFVTFHNETITAIILKDFNVCKCQG---------------CTCRGEPR
XM_001089796_Macaca.            -------RSLGLAVSTF-----PCSILKDFNACKCQS---------------LQCKGEPQ
XR_011678_Macaca_               -------KRLDLIFVTFQDSRMAKRVRKDYKY--------------------IHCGVQPQ
AK144899_Mus.                   -------QPLGMAFVTFREKSMATYILKDFNACKCQG---------------LRCKGEPQ
ENSMUST00000110185_Mus_         -------KRLDLIFVTFQDARTVRRIYDDYKY--------------------IHCGRHPK
AK159673_Mus_                   -------KPLGMAFVTFHNETITAIILKDFNVCKCQG---------------CTCRGEPR
ENSRNOT00000004519_Rattus.      -------QPLGMAFVTFREKSMATFILKDFNACKCQG---------------LRCKGEPQ
XM_001061327_Rattus_            -------KRLDLIFVTFQDARTVKRIHNDYKY--------------------INCGRHPM
XM_001064906_Rattus_            -------KPLGMAFVTFHNETITAIILKDFNVCKCQG---------------CACRGEPR
XM_547510_Canis.                -------QPLGMAFVTFQEKSMAIYILKDFNACKCQS---------------LRCKGEPQ
ENSCAFT00000027185_Canis_       -------KRLDLIFVTFQDARMTKHIREDYKY--------------------IQCGVPPQ
ENSCAFT00000003068_Canis_       -------KPLGMAFVTFHNETITAIILKDFNVCKCQG---------------CTCRGEPR
XM_001493317_Equus_             -------KRLDLIFVTFQDARMMNHVREDYKY--------------------IQCGVHPQ
XM_001497663_Equus_             -------KPLGMAFVTFHNETITAIILKDFNVCKCQG---------------CTCRGEPR
BC151398_Bos.                   -------QPLGMAFVTFQEKSMATYVLKDFNACKCQG---------------LQCKGEPQ
ENSBTAT00000021660_Bos_         -------KRLDLIFVTFQDSRMTKHILQDYKF--------------------IHCGMSPK
BC119857_Bos_                   -------KPLGMAFVTFHNETITAIILKDFNVCKCQG---------------CTCRGEPR
XM_001376602_Monodelphis.       -------HPLGMAFVTFQESSMANFILKDFNACKCQG---------------CRCKGDPQ
ENSMODT00000034227_Monodelphis_ -------KRLDVAFVTFQSEKSTSVVLKDYKW--------------------SYCGKSPQ
XM_001367034_Monodelphis_       -------KPLGMAFVTFHNESIAALILKDFNACNWQG---------------FTCQGEPR
ENSGALT00000016725_Gallus_      -------KPLGMAFVTFHNETITAIILKDFNACKCQG---------------CACRGEPR
XM_695024_Danio.                -------KPLGMAFVTFQNEAMAALILKDFNACQCHG---------------CHCRRQPK
BC139665_Danio.                 -------HPLGMAFVTLQNEYMATYILKDFNALECGGGARGVVGEEMSRGIKCGCGREPQ
ENSDART00000074802_Danio_       -------KRLGIAFVTFRDERMTAVIVKDYSR--------------------ARCRHKPQ
ENSORLT00000021166_Oryzias.     -------HTLGIAFVTLKNEAMAKYILKDFNAIECRG-S-------------TCCGREPQ
ENSORLT00000020354_Oryzias_     -------KRLGIAFVTFRDERMTAVIVKDYSR--------------------VRCRRRPQ
ENSORLT00000014664_Oryzias_     -------KPLGMAFVTFQNETITATILKDFNACKCQG---------------CHCRREPR
GSTENT00030235001_Tetraodon_    -------HPLGMAFVTLQTEAMAKQILKDFNAVDCGSKK-------------CCCGWVPQ
GSTENT00032293001_Tetraodon_    -------KRLGIAFVTFRDERMTAVIVKDYSC--------------------VSCRRRPQ
GSTENT00005617001_Tetraodon_    LPGPGLPVPAGAALVPVQRGSARPALERLLRP-------------------------RPP
SINFRUT00000173110_Takifugu.    -------KPLGMAFVTFQNEAMTAMILKDFNACKCQG---------------FHCRREPK
SINFRUT00000147037_Takifugu.    -------HPLGMAFVTLQTEAMAKYILKDFNAVDCGSKK-------------CCCGWMPQ
SINFRUT00000152743_Takifugu_    -------KRLGVAFVTFRDERMTAVIVKDYTC--------------------VSCRRRAQ
SINFRUT00000155477_Takifugu_    -------KPLGMAFVTFQNEAMTAIILKDFNACQVQG---------------CQCRQEPR
                                          .  . ..        :                                . 

HIT000040995_Homo.          383 PSSHSRELYTSKWTVTFAADPEDIC----------------WKNLSIQGLRWWLQWLGIN 426
HIT000045032_Homo_ [View]       QSSVTTIVKSYYWRVTMAPHPKDII----------------WKHLSVRRFFWWARFIAIN
HIT000306225_Homo_ [View]       PSSCSESLHISNWTVSYAPDPQNIY----------------WEHLSIRGFIWWLRCLVIN
ENSPTRT00000003734_Pan.         PSSHSRELYTSKWTVTFAADPEDIC----------------WKNLSIQGLRWWLQWLGIN
XR_024837_Pan_                  QSSVTTIVKSYYWRVTMAPHPKDII----------------WKHLSVRRFFWWARFIAIN
XR_023256_Pan_                  PSSCSESLHISNWTVSYAPDPQNIY----------------WEHLSIRGFIWWLRCLVIN
ENSPPYT00000019366_Pongo_       PSSCSESLHISNWTVSYAPDPQNIY----------------WEHLSIRGFIWWLRCLVIN
XM_001089796_Macaca.            PSSHSRELCTSKWTVTFAADPEDIC----------------WKNLSIQGLRWWLQWLGIN
XR_011678_Macaca_               QSSVTTIVKSYYWRVTMAPHPKDII----------------WKHLSVRRFFWWARFIAIN
AK144899_Mus.                   PSSYSRELCVSKWTVTFASYPEDIC----------------WKNLSIQGVRWWLQWLGIN
ENSMUST00000110185_Mus_         QSSVTTIVKNYHWRVAHAPHPKDII----------------WKHLSIRRFSWWTRFIAIN
AK159673_Mus_                   ASSCSEALHISNWTVTYAPDPQNIY----------------WEHLSIRGFIWWLRCLVIN
ENSRNOT00000004519_Rattus.      PSSYSRELCVSKWSVTFASYPEDIC----------------WKNLSIQGVRWWLQCLGIN
XM_001061327_Rattus_            QSSVTTIVKNNHWRVARAPHPKDII----------------WKHLSIRRFSWWARFIAIN
XM_001064906_Rattus_            ASSCSEALHISNWTVTYAPDPQNIY----------------WEHLSIRGFIWWLRCLVIN
XM_547510_Canis.                PSSCSKELCTSKWTVTFATYPEDIC----------------WKNLSIQGFRWWFQWLGIN
ENSCAFT00000027185_Canis_       QSSVTTIVKSYYWRVALAPHPKDII----------------WKHLSVRRFHWWARFIAIN
ENSCAFT00000003068_Canis_       SSSCSESLHISNWTVSYAPDPQNIY----------------WEHLSIRGFIWWLRCLVIN
XM_001493317_Equus_             QSSVTPIVKNYHWRVTRAPHPKDII----------------WKHLSVRCFHWWARFIAIN
XM_001497663_Equus_             SSSCSESLHISNWTVSYAPDPQNIY----------------WEHLSIRGFIWWLRCLVIN
BC151398_Bos.                   PSSHGRELRISRWSVTFAAYPEDIC----------------WKNLSIQGFRWWFQWLGIN
ENSBTAT00000021660_Bos_         ESSVTTIVKSYRWRVVRAPHPKDII----------------WKHLSVRRFHWWARFIAIN
BC119857_Bos_                   SSSCSESLHISNWTVSYAPDPQNIY----------------WEHLSIRGFIWWLRCLVIN
XM_001376602_Monodelphis.       PSSYSKELGPSNWTVAFATYPEDIC----------------WKNLSIQGLRWWFQWSGIN
ENSMODT00000034227_Monodelphis_ QSSVTSEIQSHRWKVYYASHPKDII----------------WEHLRIRGFYWWARFLFIN
XM_001367034_Monodelphis_       SSSCSDSLNINNWTVSFAPDPQNIY----------------WENLSIRGFTWWFRCLIIN
ENSGALT00000016725_Gallus_      ASSCSESLHVSNWTVSYAPDPQNIY----------------WEHLSIRGFIWWIRCLVIN
XM_695024_Danio.                SSPFSSQLHTYNWTVSYAPDPQNVY----------------WEHLSISGLNWWVRCFVIN
BC139665_Danio.                 PSTRSAELGVPKWKVNYASHPHNIY----------------WENLSVRGWRWLLRCVLLN
ENSDART00000074802_Danio_       QSSITTVVRSHQWDVSYAPAPNDII----------------WENLSVCGPRWWLRCILLN
ENSORLT00000021166_Oryzias.     PSSQSRALKVNKWRVSFAPHPKSVY----------------WENLSVRGFTWAVRYVLIN
ENSORLT00000020354_Oryzias_     QSSITTVVQSHKWGVSYAPAPSDII----------------WKTVPSELFGFWAKLYALS
ENSORLT00000014664_Oryzias_     RSNHSKTLQTHNWTVMYAPHPQNVY----------------WEHLSVGGAKWWLRCLLIN
GSTENT00030235001_Tetraodon_    PSSNSDALKVKEWMVNFAPHPENVY----------------WDNLSVRGCFWFLRYVLIN
GSTENT00032293001_Tetraodon_    QSSVTTVVQSHKWGVSYAPAPSDII----------------WENLSVCGSRWWLRCVLLN
GSTENT00005617001_Tetraodon_    ERPLVGRRRS-SW--SRTGLSSSLL----------------LQGTSVLGGRLLVDPLLRH
SINFRUT00000173110_Takifugu.    SSQFSSKLQTYNWSVGYAPDPQNVY----------------WEHLSLGGFSWWCRCLIIN
SINFRUT00000147037_Takifugu.    PSSNSDTLKVHEWMVSFAPHPENVY----------------WNNLSVRGFCWFLRYLMIN
SINFRUT00000152743_Takifugu_    QSSVTTVVQSHKWGVSYAPAPSDII----------------WENLSVCGSRWWLRCVLLN
SINFRUT00000155477_Takifugu_    SSQLSEVLHVHNWNVSYAPDPQNVRWYMTKKMFRSPKQLQPWEHLSLGGISWWIRCFIIN
                                            *    :  . .:                  .                 

HIT000040995_Homo.          427 FT------------------------------------------------------LFLG 432
HIT000045032_Homo_ [View]       TF------------------------------------------------------LFFL
HIT000306225_Homo_ [View]       VV------------------------------------------------------LFIL
ENSPTRT00000003734_Pan.         FT------------------------------------------------------LFLG
XR_024837_Pan_                  TF------------------------------------------------------LFFL
XR_023256_Pan_                  VV------------------------------------------------------LFIL
ENSPPYT00000019366_Pongo_       VV------------------------------------------------------LFIL
XM_001089796_Macaca.            FT------------------------------------------------------LFLG
XR_011678_Macaca_               TF------------------------------------------------------LFFL
AK144899_Mus.                   FS------------------------------------------------------LFVV
ENSMUST00000110185_Mus_         TF------------------------------------------------------LFFL
AK159673_Mus_                   VV------------------------------------------------------LFIL
ENSRNOT00000004519_Rattus.      FS------------------------------------------------------LFVV
XM_001061327_Rattus_            TS------------------------------------------------------LFFL
XM_001064906_Rattus_            VV------------------------------------------------------LFIL
XM_547510_Canis.                FT------------------------------------------------------LFVG
ENSCAFT00000027185_Canis_       TF------------------------------------------------------LFFL
ENSCAFT00000003068_Canis_       VV------------------------------------------------------LFIL
XM_001493317_Equus_             TF------------------------------------------------------LFFL
XM_001497663_Equus_             VV------------------------------------------------------LFIL
BC151398_Bos.                   FI------------------------------------------------------LFVV
ENSBTAT00000021660_Bos_         TF------------------------------------------------------LFFL
BC119857_Bos_                   VV------------------------------------------------------LFIL
XM_001376602_Monodelphis.       FI------------------------------------------------------LSVV
ENSMODT00000034227_Monodelphis_ SC------------------------------------------------------LFFL
XM_001367034_Monodelphis_       VV------------------------------------------------------LFLL
ENSGALT00000016725_Gallus_      VV------------------------------------------------------LFIL
XM_695024_Danio.                CF------------------------------------------------------LFLL
BC139665_Danio.                 TA------------------------------------------------------LFVL
ENSDART00000074802_Danio_       IL------------------------------------------------------LFLL
ENSORLT00000021166_Oryzias.     LL------------------------------------------------------LFLL
ENSORLT00000020354_Oryzias_     FV------------------------------------------------------CFLF
ENSORLT00000014664_Oryzias_     CI------------------------------------------------------LFLL
GSTENT00030235001_Tetraodon_    FF------------------------------------------------------LFVL
GSTENT00032293001_Tetraodon_    IL------------------------------------------------------LFLL
GSTENT00005617001_Tetraodon_    QLHPVPPALLPHHAGHHHLHHGQVQRHQACGVPEQPHRDPVLPDPPALGLLRPAAHHRLL
SINFRUT00000173110_Takifugu.    II------------------------------------------------------LFLL
SINFRUT00000147037_Takifugu.    LF------------------------------------------------------LFVL
SINFRUT00000152743_Takifugu_    IL------------------------------------------------------LFLL
SINFRUT00000155477_Takifugu_    CI------------------------------------------------------LFIL
                                                                                          . 

HIT000040995_Homo.          433 LFFLTTP-SIILSTMDKFNVTKPIHALNNPII----SQFFPTLLLWSFSALLPSIVYYST 487
HIT000045032_Homo_ [View]       FFFLTTP-AIIMNTIDMYNVTRPIEKLQNPIV----TQFFPSVMLWGFTVILPLIVYFSA
HIT000306225_Homo_ [View]       LFFLTTP-AIIITTMDKFNVTKPVEYLNNPII----TQFFPTLLLWCFSALLPTIVYYSA
ENSPTRT00000003734_Pan.         LFFLTTP-SIILSTMDKFNVTKPIHALNNPII----SQFFPTLLLWSFSALLPSIVYYST
XR_024837_Pan_                  FFFLTTP-AIIMNTIDMYNVTRPIEKLQNPIV----TQFFPSVMLWGFTVILPLIVYFSA
XR_023256_Pan_                  LFFLTTP-AIIITTMDKFNVTKPVEYLNNPII----TQFFPTLLLWCFSALLPTIVYYSA
ENSPPYT00000019366_Pongo_       LFFLTTP-AIIITTMDKFNVTKPVEYLN--------------------------------
XM_001089796_Macaca.            LFFLTTP-SIILSTMDKFNVTKPIHALNNPII----SQFFPTLLLWSFSALLPSIVYYST
XR_011678_Macaca_               FFFLTTP-AIIMNTIDMYNVTRPIEKLQSPIV----TQFFPSVMLWGFTVILPLIVYFSA
AK144899_Mus.                   LFFLTTP-SIIMSTMDKFNVTKPIHALNNPVI----SQFFPTLLLWSFSALLPSIVYYST
ENSMUST00000110185_Mus_         FFFLTTP-AIIINTIDIYNVTRPIEKLQSPIV----TQFFPSVLLWAFTVTMPLLVYLSA
AK159673_Mus_                   LFFLTTP-AIIITTMDKFNVTKPVEYLNNPII----TQFFPTLLLWCFSALLPTIVYYSA
ENSRNOT00000004519_Rattus.      LFFLTTP-SIIMSTMDKFNVTKPIHALNNPVI----SQFFPTLLLWSFSALLPTIVYYST
XM_001061327_Rattus_            FFFLTTP-AIIINTIDMYNVTRPIEKLQSPVV----TQFFPSVLLWAFTVIMPLLVYFSA
XM_001064906_Rattus_            LFFLTTP-AIIITTMDKFNVTKPVEYLNNPII----TQFFPTLLLWCFSALLPTIVYYSA
XM_547510_Canis.                LFFLTTP-SIILSTIDKFNVTKPIHELNDPVI----SQFFPTLLLWSFSALLPTIVYYST
ENSCAFT00000027185_Canis_       FFFLTTP-AIIINTIDMYNVTRPIEKLQSPVI----TQFFPSLMLWAFTVILPLIVYLSA
ENSCAFT00000003068_Canis_       LFFLTTP-AIIITTMDKFNVTKPVEYLNNPII----TQFFPTLLLWCFSALLPTIVYYSA
XM_001493317_Equus_             FFFLTTP-AIIINTIDMYNVTRPIEKLQNPIV----TQFFPSLMLWAFTVILPLIVYLSA
XM_001497663_Equus_             LFFLTTP-AIIITTMDKFNVTKPVEYLNNPII----TQFFPTLLLWCFSALLPTIVYYSA
BC151398_Bos.                   LFFLTTP-SIILSTMDKFNVTKPIHALNNPVI----SQFFPTLLLWSFSALLPTIVYYST
ENSBTAT00000021660_Bos_         FFFLTTP-AIIINTIDLYNVTRPIENLQSPIV----TQFFPSVLLWAFTVTLPLIVYLSA
BC119857_Bos_                   LFFLTTP-AIIITTMDKFNVTKPVEYLNNPII----TQFFPTLLLWCFSALLPTIVYYSA
XM_001376602_Monodelphis.       LFFLTTP-SIILSTMDKFNVTKPIHALNDPII----SQFFPTLLLWSFSALLPSIVYYST
ENSMODT00000034227_Monodelphis_ IFFLTTP-SNIMTTIITLNVTRPIRNVKNPII----NQFFSCVLLWACTVILPFIVYYSS
XM_001367034_Monodelphis_       LFFLTTP-AIIITTMDKFNVTKPVEFLNNPII----TQFFPTLLLWCFSALLPTIVYYST
ENSGALT00000016725_Gallus_      LFFLTTP-AIIITTMDKFNVTKPVEYLNNPII----TQFFPTLLLWCFSALLPTIVYYSA
XM_695024_Danio.                LFFLTTP-AIIISTMDKFNVTKPVEYLNNPIV----TQFFPTLLLWCFSALLPTIVYYSA
BC139665_Danio.                 LFFLTTP-SIIISTMDKFNVTMPIYYLNSPII----SQFFPTLMLWTFSALLPTIVYYST
ENSDART00000074802_Danio_       LFFLTTP-AIIVNTMDKFNVTRPVESLRNPVI----TQFFPTLLLWAFSILLPFIVYYSS
ENSORLT00000021166_Oryzias.     LTFLTTP-TIIINTFDKFNVTKPIYYLNSPII----TQFFPTLLLWSFSALLPTIVYYST
ENSORLT00000020354_Oryzias_     SFRTTTP-AIIVNTMDKFNVTRPVESLRSPVI----TQFLPTLLLWAFSVLLPFIVYYSA
ENSORLT00000014664_Oryzias_     LFFLTTP-AIIISTMDKFNVTKPVEYLNNPIV----TQFFPTLLLWSFSALLPTIVYYSA
GSTENT00030235001_Tetraodon_    LTFLTTP-TIIITTIDKFNVTRPIHYLNSPII----SQFFPTLLLWSFSALLPTIVYYST
GSTENT00032293001_Tetraodon_    LFFLTTP-AIIVNTMDKFNVTRPVESLRSPVI----TQFLPTLLLWAMSVLLPFIVYYSA
GSTENT00005617001_Tetraodon_    LGFLRGPLDQVWREQDHDAQVLHLPDLHGPAAAVSGTQQVPTCGPRVPAVPPPSPLSLFP
SINFRUT00000173110_Takifugu.    LFFLTTP-AIIISTMDKFNVTKPVEYLNNPIV----TQFFPTLLLWSFSALLPTIVYYSA
SINFRUT00000147037_Takifugu.    LAFLTTP-SIIITTIDKFNVTRPIQYLNSPII----SQFFPTLLLWTFSALLPTIVYYST
SINFRUT00000152743_Takifugu_    LFFLTTP-AIIVNTMDKFNVTRPVESLRSPVI----TQFLPTLLLWAMSVLLPFIVYYSA
SINFRUT00000155477_Takifugu_    LFFLTTP-AIIISTMDKFNVTKPVEYLNNPII----TQFFPTLLLWAFSALLPTIVYYSA
                                      *   :         .  :  :.                                

HIT000040995_Homo.          488 LLESHWTKSGENQIMMTKVYIFLIFMVLILPSLG-------------------------- 521
HIT000045032_Homo_ [View]       FLEAHWTRSSQNLVMVHKCYIFLVFMVVILPSMG--------------------------
HIT000306225_Homo_ [View]       FFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLG--------------------------
ENSPTRT00000003734_Pan.         LLESHWTKSGENQIMMTKVYIFLIFMVLILPSLG--------------------------
XR_024837_Pan_                  FLEAHWTRSSQNLVMVHKCYIFLVFMVVILPSMG--------------------------
XR_023256_Pan_                  FFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLG--------------------------
ENSPPYT00000019366_Pongo_       --------SGENRTTMHKCYTFLIFMVLLLPSLG--------------------------
XM_001089796_Macaca.            LLESHWTKSGENQIVMTKVYIFLIFMVLILPSLG--------------------------
XR_011678_Macaca_               FLEAHWTRSSQNLVMVHKCYIFLVFMVVILPSMG--------------------------
AK144899_Mus.                   LLESHWTRSGENRIMVSKVYIFLIFMVLILPSLG--------------------------
ENSMUST00000110185_Mus_         FLEAHWTRSSQNLIIVHKCYIFLVFMVVILPSMG--------------------------
AK159673_Mus_                   FFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLG--------------------------
ENSRNOT00000004519_Rattus.      LLESHWTRSGENRIMVSKVYIFLIFMVLILPSLG--------------------------
XM_001061327_Rattus_            FLEAHWTRSNQNLIIMYKCYIFLVFMVVILPSMG--------------------------
XM_001064906_Rattus_            FFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLG--------------------------
XM_547510_Canis.                LLESHWTKSGENRIMMSKVYIFLIFMVLILPSLG--------------------------
ENSCAFT00000027185_Canis_       FLEAHWTRSSQNLIIVNKCYIFLVFMVIILPSMG--------------------------
ENSCAFT00000003068_Canis_       FFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLG--------------------------
XM_001493317_Equus_             FLEAHWTRSGQNLIIVHKCYVFLVFMVVILPSMG--------------------------
XM_001497663_Equus_             FFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLG--------------------------
BC151398_Bos.                   LLESHWTKSGENWIMMTKVYIFLIFMVLILPSLG--------------------------
ENSBTAT00000021660_Bos_         FLEAHWTRTSQNLIIAHKCYVFLVFMVVILPSMG--------------------------
BC119857_Bos_                   FFEAHWTRSGENRTTMHKCYTFLLFMVLLLPSLG--------------------------
XM_001376602_Monodelphis.       LLESHWTKSGENRIMMIKVYIFLIFMVLILPSLG--------------------------
ENSMODT00000034227_Monodelphis_ FLEKHWTRSTQNLFTVFKCYFLLIFMVIILPSLG--------------------------
XM_001367034_Monodelphis_       FLESHWTRSGENRTTMHKCYTFLIFMVLLLPSLG--------------------------
ENSGALT00000016725_Gallus_      FFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLG--------------------------
XM_695024_Danio.                FFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLG--------------------------
BC139665_Danio.                 LGEAHWTRSSENMSMMYKLYTFLIFMVLILPSLG--------------------------
ENSDART00000074802_Danio_       FFEYHWTRSGENQVTMHKCFLLLVFMVIILPSLG--------------------------
ENSORLT00000021166_Oryzias.     LGEAHWSRSSEQLSMMRKLYFFLLFMVLILPSLG--------------------------
ENSORLT00000020354_Oryzias_     FFESHWTRSGQNQVTMHKCFLLLVFMVIILPSLG--------------------------
ENSORLT00000014664_Oryzias_     FFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLG--------------------------
GSTENT00030235001_Tetraodon_    IGEAHWSRSSEQLSMMRKLYCFLLFMVLLLPSLG--------------------------
GSTENT00032293001_Tetraodon_    FFESHWTRSGENQVTMHKCFLLLIFMVIILPSLG--------------------------
GSTENT00005617001_Tetraodon_    CLSSAWTSSSAGSSIRSSWQT--------GPSDS--------------------------
SINFRUT00000173110_Takifugu.    FFEAHWTRSIQNRTTMHKCYTFLIFMVLLLPSLGLSRYFCCSCFTYCKSRLIPTCHPCLI
SINFRUT00000147037_Takifugu.    IGEAHWSRSSEQLSMMRKLYFFLLFMVLLLPSLG--------------------------
SINFRUT00000152743_Takifugu_    FFESHWTRSGENQVTMHKCFLLLIFMVIILPSLG--------------------------
SINFRUT00000155477_Takifugu_    FFEAHWTR----------------------------------------------------
                                                                                            

HIT000040995_Homo.          522 ------LTSLDFFFRWLFDKT-SSEASIRLECVFLPDQGAFFVNYVIA---------SAF 565
HIT000045032_Homo_ [View]       ------LTSLDVFLRWLFDIYYLEQASIRFQCVFLPDNGAFFVNYVIT---------AAL
HIT000306225_Homo_ [View]       ------LSSLDLFFRWLFDKKFLAEAAIRFECVFLPDNGAFFVNYVIA---------SAF
ENSPTRT00000003734_Pan.         ------LTSLDFFFRWLFDKT-SSEASIRLECVFLPDQGAFFVNYVIA---------SAF
XR_024837_Pan_                  ------LTSLDVFLRWLFDIYYLEQASIRFQCVFLPDNGAFFVNYVITAAYESXXXXAAL
XR_023256_Pan_                  ------LSSLDLFFRWLFDKKFLAEAAIRFECVFLPDNGAFFVNYVIA---------SAF
ENSPPYT00000019366_Pongo_       ------LSSLDLFFRWLFDKKFLAEAAIRFECVFLPDNGAFFVNYVIA---------SAF
XM_001089796_Macaca.            ------LTSLDFFFRWLFDKT-SSKASIRLECVFLPDQGAFFVNYIIA---------SAF
XR_011678_Macaca_               ------LTSLDVFLRWLFDIYYLEQASIRFQCVFLPDNGAFFVNYVIT---------AAL
AK144899_Mus.                   ------LTSLDFFFRWLFDKT-SSETSIRLECVFLPDQGAFFVNYVIA---------SAF
ENSMUST00000110185_Mus_         ------LTSLHVFLRWLFDIYYLEHATIRFQCVFLPDNGAFFINYVIT---------AAL
AK159673_Mus_                   ------LSSLDLFFRWLFDKKFLAEAAIRFECVFLPDNGAFFVNYVIA---------SAF
ENSRNOT00000004519_Rattus.      ------LTSLDFFFRWLFDKT-SSDTSIRLECVFLPDQGAFFVNYVIA---------SAF
XM_001061327_Rattus_            ------LTSLDVFLRWLFDIYYLEHATIRFQCVFLPDNGAFFINYVIT---------SAL
XM_001064906_Rattus_            ------LSSLDLFFRWLFDKKFLAEAAIRFECVFLPDNGAFFVNYVIA---------SAF
XM_547510_Canis.                ------LTSLDFFFRWLFDKT-SSEASIRLECVFLPDQGAFFVNYVIA---------SAF
ENSCAFT00000027185_Canis_       ------LTSLDVFFRWLFDIYYLEQASIRFQCVFLPDNGAFFVNYVIT---------AAL
ENSCAFT00000003068_Canis_       ------LSSLDLFFRWLFDKKFLAEAAIRFECVFLPDNGAFFVNYVIA---------SAF
XM_001493317_Equus_             ------LTSLDVFLRWLFDIYYLDQATIRFQCVFLPDNGAFFVNYVIT---------AAF
XM_001497663_Equus_             ------LSSLDLFFRWLFDKKFLAEAAIRFECVFLPDNGAFFVNYVIA---------SAF
BC151398_Bos.                   ------LTSLDFFFRWLFDKT-SSEASIRLECVFLPDQGAFFVNYVIA---------SAF
ENSBTAT00000021660_Bos_         ------LTSLDVFLHWLFDIYYLEQASVRFQCVFLPDNGAFFVNYVIT---------AAF
BC119857_Bos_                   ------LSSLDLFFRWLFDKKFLAEAAIRFECVFLPDNGAFFVNYVIA---------SAF
XM_001376602_Monodelphis.       ------LTSLDFFFRWLFDKA-SSETSIRLECVFLPDQGAFFVNYVIA---------SAF
ENSMODT00000034227_Monodelphis_ ------LTSLNVFFRWLFDSAFLDKAYVKFRCVFLPDNGAFFVNYVIT---------TSL
XM_001367034_Monodelphis_       ------LTSLDFFFRWLFDKKFLAEAAIRFECVFLPDNGAFFVNYVIA---------SAF
ENSGALT00000016725_Gallus_      ------LSSLDVFFRWLFDKKFLAEAAVRFECVFLPDNGAFFVNYVIA---------SAF
XM_695024_Danio.                ------LSSLDLFFRWLFDKKFLDEATIRFRCVFLPDNGAFFVNYVIA---------SAF
BC139665_Danio.                 ------LTSLAVFFRWLFDKQ--SEGQLRFECVFLADQGAFFVNYVIA---------AAL
ENSDART00000074802_Danio_       ------LSSLNLFFRWLFDVRFLDETDVKFQCVFLPDNGAFFVNYVIT---------SSL
ENSORLT00000021166_Oryzias.     ------LTSLAVFFRWLFDKEFLNLGKLRFECVFLPDQGAFFVNYVIA---------AGL
ENSORLT00000020354_Oryzias_     ------LSSLDLFFTWLFDVNFLEEKEVKFQCVFLPDNGAFFVNYVIT---------SSL
ENSORLT00000014664_Oryzias_     ------LTSLDVFFRWLFDKKFLADAKVRFECVFLPDNGAFFVNYVIA---------SAF
GSTENT00030235001_Tetraodon_    ------LTSLAVFFRWLFDKEFLIGGKMRFECVFLPNQGAFFVNYVIA---------AAL
GSTENT00032293001_Tetraodon_    ------LTSLDLFFTWLFDINFLDEKDVKFQCVFLPDNGAFFVNYVIT---------SSL
GSTENT00005617001_Tetraodon_    ------STCPTASARPPPSHMTPVWTLVSLRCVFLPDNGAFFVNYVIA---------SAF
SINFRUT00000173110_Takifugu.    QLIFLFLSSLDLFFRWLFDRRFLADVKVRFECVFLPDNGAFFVNYVIA---------SAF
SINFRUT00000147037_Takifugu.    ------LTSLAYFFRWLFDKTFLADGKVRFECVFLPDQGAFFVNYVIA---------AAL
SINFRUT00000152743_Takifugu_    ------LTSLDLFFTWLFDINFLDEKDVKFQCVFLPDNGAFFVNYVIT---------SSL
SINFRUT00000155477_Takifugu_    -------------------------------CVFLPDNGAFFVNYVIA---------SAF
                                                               ****.::****:**:*:         :.:

HIT000040995_Homo.          566 IGNGMELLRLPGLILYTFRMIMAKTAADRRNVKQNQAFQYEFGAMYAWMLCVFTVIVAYS 625
HIT000045032_Homo_ [View]       LGTGMELLRLGSLFCYSTRLFFSRSEPERVNIRKNQAIDFQFGREYAWMMNVFSVVMAYS
HIT000306225_Homo_ [View]       IGNAMDLLRIPGLLMYMIRLCLARSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYS
ENSPTRT00000003734_Pan.         IGNGMELLRLPGLILYTFRMIMAKTAADRRNVKQNQAFQYEFGAMYAWMLCVFTVIVAYS
XR_024837_Pan_                  LGTGMELLRLGSLFCYSTRLFFSRSEPERVNIRKNQAIDFQFGREYAWMMNVFSVVMAYS
XR_023256_Pan_                  IGNAMDLLRIPGLLMYMIRLCLARSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYS
ENSPPYT00000019366_Pongo_       IGNAMDLLRIPGLLMYMIRLCLARSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYS
XM_001089796_Macaca.            IGNGMELLRLPGLILYTFRMIMAKTAADRRNVKQNQAFQYEFGAMYAWMLCVFTVIMAYS
XR_011678_Macaca_               LGTGMELLRLGSLFCYSTRLFFSRSEPERVNIRKNQAIDFQFGREYAWMMNVFSVVMAYS
AK144899_Mus.                   IGSGMELLRLPGLILYTFRMIMAKTAADRRNVKQNQAFEYEFGAMYAWMLCVFTVIMAYS
ENSMUST00000110185_Mus_         LGTGMELMRLGSLCTYCTRLFLSKSEPERVHIRKNQATDFQFGREYAWMLNVFSVVMAYS
AK159673_Mus_                   IGNAMDLLRIPGLLMYMIRLCLARSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYS
ENSRNOT00000004519_Rattus.      IGSGMELLRLPGLILYTFRMIMAKTAADRRNVKQNQAFEYEFGAMYAWMLCVFTVIMAYS
XM_001061327_Rattus_            FGTGMELMRLGSLCTYCTRLFLSRSEPERVHIRKNLAMDFQFGREYAWMLNVFSVVMAYS
XM_001064906_Rattus_            IGNAMDLLRIPGLLMYMIRLCLARSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYS
XM_547510_Canis.                IGNGMELLRLPGLILYTFRMIMAKTAADRRNIKQNQAFQFEFGAMYAWMLCVFTVIVAYS
ENSCAFT00000027185_Canis_       LGTGMELLRLGSLFLYSIRLFFSRSEPERVHIRKSQAMDFQYGREYAWMMNVFSVVIAYS
ENSCAFT00000003068_Canis_       IGNAMDLLRIPGLLMYMIRLCLARSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYS
XM_001493317_Equus_             LGTGMDLLRLGSLFLYSTRLFFSRSEPERVHIRQRQAMDFQFGREYAWMSNVFSVVMAYS
XM_001497663_Equus_             IGNAMDLLRIPGLLMYMIRLCLARSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYS
BC151398_Bos.                   IGNGMELLRLPGLILYTFRMVMAKTAADRKNVKQNQAFEYEFGAMYAWMLCVFTVIMAYS
ENSBTAT00000021660_Bos_         IGTGMELMRLGSLFLYTIRLVFSRSEPERVNIRMNQAMDFQYGREYAWMMNVFSVVMAYS
BC119857_Bos_                   IGNAMDLLRIPGLLMYMIRLCLARSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYS
XM_001376602_Monodelphis.       IGNGMELLRLPGLILYTIRMIMAKTAADRRNLKQQQAFEYEFGAMYAWMLCVFTVIMAYS
ENSMODT00000034227_Monodelphis_ IGMGCELLRVESLLFYAIRLFFSQSEAERINIRQDQTIAFEYGREYSWICCVIGVVMSYS
XM_001367034_Monodelphis_       IGNAMDLLRIPGLLLYMIRLCLAHSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYS
ENSGALT00000016725_Gallus_      IGNAMDLLRIPGLLMYMIRLCLARSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYS
XM_695024_Danio.                IGNAMDLLRIPYFLMYMIRLCLARSAAERRNVKKHQAYEFQFGAAYAWMMNVFTVVMTYS
BC139665_Danio.                 VGSGMELLRLPGLLLYIVRLALASSAAERKYVKQNQAYEFQYGAMYGWTLCVFTVIMAYS
ENSDART00000074802_Danio_       IGTAMELLRIPALLVYSLRLCFAKSKAECIHVKISQAYEFQFGLEYAWTMCIFSVSMTYS
ENSORLT00000021166_Oryzias.     VGSGMDLLRLPGLLLYLIRMMLARSAAERKYVKQNQAYEFEYGAMYGWTLCVFTVIMAYS
ENSORLT00000020354_Oryzias_     IGTSMELLRIPALTVYAFRLCFAKSQAERIHVKKSQAYEFQFGLEYAWTMCIFAVSMTYS
ENSORLT00000014664_Oryzias_     IGNAMDLLRIPGLLMYMIRLCLARSAADRRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYS
GSTENT00030235001_Tetraodon_    VGSGMELLRLPGLLLYTIRMAFARSGAERKYVKQNQAYEFEYGAMYAWSLCVFTVIMAYS
GSTENT00032293001_Tetraodon_    IGTSMELLRIPALSVYMLRLCFARSQAERIHIKRSQAYEFQFGLEYAWTMCIFAVSVTYS
GSTENT00005617001_Tetraodon_    IGNAMDLLRIPGLLMYMIRLCLARSAADRRNVKRHQAYEFQFGAAYAWMMNVFTVVMAYS
SINFRUT00000173110_Takifugu.    IGNANDLLRIPGLLMYMIRLCLARSAAERKNVKRHQAYEFQFGAAYAWMMCVFTVVMTYS
SINFRUT00000147037_Takifugu.    VGSGMELLRLPGLLLYTIRMALARSSAERKYVKQNQAYEFEYGAMYAWALCVFTVIMAYS
SINFRUT00000152743_Takifugu_    IGTSMELLRIPALSVYTLRLCFAKSQAERIHIKRSQAYEFQFGLEYAWTMCIFAVSVTYS
SINFRUT00000155477_Takifugu_    IGNAMDLLRIPGLLMYMIRLCLARSAADRRNVKRHQAYEFQFGAAYAWMMNVFTVVMAYS
                                .* . :*:*:  :  *  *: :: : .:   ::   :  :::*  *.*   :: * ::**

HIT000040995_Homo.          626 ITCPIIAPFGLIYILLKHMVDRHNLYFVYLPAKLEKGIHFAAVNQALAAPILCLFWLYFF 685
HIT000045032_Homo_ [View]       ITCPIIVPFGLLYLCMKHLTDRYNMYYSFAPTKLNEQIHMAAVSQAIFAPLLGLFWMLFF
HIT000306225_Homo_ [View]       ITCPIIVPFGLMYMLLKHLVDRYNLYYAYLPAKLDKKIHSGAVNQVVAAPILCLFWLLFF
ENSPTRT00000003734_Pan.         ITCPIIAPFGLIYILLKHMVDRHNLYFVYLPAKLEKGIHFAAVNQALAAPILCLFWLYFF
XR_024837_Pan_                  ITCPIIVPFGLLYLCMKHLTDRYNMYYSFAPTKLNEQIHMAAVSQAIFAPLLGLFWMLFF
XR_023256_Pan_                  ITCPIIVPFGLMYMLLKHLVDRYNLYYAYLPAKLDKKIHSGAVNQVVAAPILCLFWLLFF
ENSPPYT00000019366_Pongo_       ITCPIIVPFGLMYMLLKHLVDRYNLYYAYLPAKLDKKIHSGAVNQVVAAPILCLFWLLFF
XM_001089796_Macaca.            ITCPIVAPFGLIYILLKHMVDRHNLYFVYLPAKLEKGIHFAAVNQALAAPILCLFWLYFF
XR_011678_Macaca_               ITCPIIVPFGLLYLCMKHLTDRYNMYYSFAPTKLNEQIHMAAVSQAIFAPLLGLFWMLFF
AK144899_Mus.                   ITCPIIVPFGLIYILLKHMVDRHNLYFAYLPAKLEKRIHFAAVNQALAAPILCLFWLFFF
ENSMUST00000110185_Mus_         ITCPIIVPFGLLYLCMKHITDRYNMYYSYAPTKLNAQIHMAAVYQAIFAPLLGLFWMLFF
AK159673_Mus_                   ITCPIIVPFGLMYMLLKHLVDRYNLYYAYLPAKLDKKIHSGAVNQVVAAPILCLFWLLFF
ENSRNOT00000004519_Rattus.      ITCPIIVPFGLIYILLKHMVDRHNLYFAYLPAKLEKRIHFAAVNQALAAPILCLFWLFFF
XM_001061327_Rattus_            ITCPIIVPFGLLYLCMKHITDRYNMYYSYAPTKLNAQIHMAAVYQAIFAPLLGLFWMLFF
XM_001064906_Rattus_            ITCPIIVPFGLMYMLLKHLVDRYNIYYAYLPAKLDKKIHSGAVNQVVAAPILCLFWLLFF
XM_547510_Canis.                ITCPIIAPFGLIYILLKHMVDRHNLYFAYLPAKLEKRIHLAAVNQALAAPILCLFWLYFF
ENSCAFT00000027185_Canis_       ITCPIIVPFGLLYLCMKHITDRYNMYYSYAPTKLNEQIHMAAVYQAIFAPLLGLFWMLFF
ENSCAFT00000003068_Canis_       ITCPIIVPFGLMYMLLKHLVDRYNLYYAYLPAKLDKKIHSGAVNQVVAAPILCLFWLLFF
XM_001493317_Equus_             ITCPIIVPFGLLYLCMKHVTDRYNMYYSFAPTKLNEQIHMAAVYQAMFAPILGLCWMLFF
XM_001497663_Equus_             ITCPIIVPFGLMYMLLKHLVDRYNLYYAYLPAKLDKKIHSGAVNQVVAAPILCLFWLLFF
BC151398_Bos.                   ITCPIIVPFGLIYILLKHMVDRHNLYFAYLPAKLEKRIHFAAVNQALAAPILCLFWLYFF
ENSBTAT00000021660_Bos_         ITCPIIAPFGLLYLCMKHVTDRYNMYYSYAPTKLNEQIHMAAIHQAIFAPLLGLVWMLFF
BC119857_Bos_                   ITCPIIVPFGLMYMLLKHLVDRYNLYYAYLPAKLDKKIHSGAVNQVVAAPILCLFWLLFF
XM_001376602_Monodelphis.       ITCPIIVPFGLIYILLKHMVDRHNLYFAYLPTKLEKKIHFAAVNQALAAPILCLFWLYFF
ENSMODT00000034227_Monodelphis_ ITCPIIVPFGLLYVCMKHITDKYNLYYAYAPTKLKEDFHLVGVYQVMVAPILAILWLLFF
XM_001367034_Monodelphis_       ITCPIIVPFGLMYMLLKHLVDRYNLYYAYLPAKLDKKIHAAAVTQVVAAPILCLFWLLFF
ENSGALT00000016725_Gallus_      ITCPIIVPFGLMYMLLKHLVDRYNLYYAYLPAKLDKKIHSGAVNQVVAAPILCLFWLLFF
XM_695024_Danio.                ITCPIIVPFGLMYMLLKHLVDRYNMYYAYLPSKLDKKIHSGAVNQVVAAPILCIFWLLFF
BC139665_Danio.                 IVCPLIVPFGLLYLLLKHLVDKHNLYFAYLPARLDRQVHLGAVNQALAAPIICLIWLYFF
ENSDART00000074802_Danio_       ITCPVIVPFGLLYLVLKHMVDRYNIYYAYTPTKLNQRIHAAAISQVVVAPILCMFWLLFF
ENSORLT00000021166_Oryzias.     IICPIIVPFGLLYMLLKHLVDRHNLYFAYLPTRLDHQVHMGAVDQALAAPIICLIWLYFF
ENSORLT00000020354_Oryzias_     ITCPIITPFGLLYAILKHMVD-YNIYYAYIPTKLNQRIHRAA-PQVIVAPILCIFWLLFF
ENSORLT00000014664_Oryzias_     ITCPIIVPFGLMYMLLKHLADRYNMYYAYLPSKLDKKIHSGAVNQVVAAPILCLSWLLFF
GSTENT00030235001_Tetraodon_    IICPIIVPFGFLYMTLKHLVDKHNLYFAYLPARIERHVHLGAVNQALAAPIICLIWLYFF
GSTENT00032293001_Tetraodon_    ITCPIITPFGLLYVILKHMVDRYNMYYAYVPTKLSQRIHRAAISQVLVAPILCMFWLLFF
GSTENT00005617001_Tetraodon_    ITCPIIVPFGLMYMLLKHLVDRYNMYYAYLPSKLDKKIHSGAVTQVVAAPILCLFWLLFF
SINFRUT00000173110_Takifugu.    ITCPIIVPFGLMYMLLKHLADRYNMYYAYLPTKLDKKIHSGAVNQVVAAPILCLFWLLFF
SINFRUT00000147037_Takifugu.    IICPIIVPFGFLYMMLKYLVDKHNLYFAYLPARSEHHVHLGAVNQALAAPIICLIWLYYF
SINFRUT00000152743_Takifugu_    ITCPIITPFGLLYVILKHMVDRYNMYYAYVPTKLSQRIHRAAISQVMVAPVLCMFWLLFF
SINFRUT00000155477_Takifugu_    ITCPIIVPFGLMYMLLKHLVDRYNMYYAYLPSKLDKKIHSGAVTQVVAAPILCLFWLLFF
                                * **::.***::*  :*::.* :*:*: : *:: .  .*  .  *.: **:: : *: :*

HIT000040995_Homo.          686 SFLR-----------------------------------------LGMKA---PATLFTF 701
HIT000045032_Homo_ [View]       SILR-----------------------------------------LGSLH---AITIFSL
HIT000306225_Homo_ [View]       STMR-----------------------------------------TGFLA---PTSMFTF
ENSPTRT00000003734_Pan.         SFLR-----------------------------------------LGMKA---PATLFTF
XR_024837_Pan_                  SILR-----------------------------------------LGSLH---AITIFSL
XR_023256_Pan_                  STMR-----------------------------------------TGFLA---PTSMFTF
ENSPPYT00000019366_Pongo_       STMR-----------------------------------------TGFLA---PTSMFTF
XM_001089796_Macaca.            SFLR-----------------------------------------LGMKA---PATLFTF
XR_011678_Macaca_               SLLR-----------------------------------------LGSLH---AITMFSL
AK144899_Mus.                   SFLR-----------------------------------------LGLTA---PATLFTF
ENSMUST00000110185_Mus_         SILR-----------------------------------------VGSLH---SITLFSM
AK159673_Mus_                   STMR-----------------------------------------TGFLA---PTSMFTF
ENSRNOT00000004519_Rattus.      SFLR-----------------------------------------LGLTA---PATLFTF
XM_001061327_Rattus_            SILR-----------------------------------------VGSLH---SITLFSL
XM_001064906_Rattus_            STMR-----------------------------------------TGFLA---PTSMFTF
XM_547510_Canis.                SFLR-----------------------------------------LGLKA---PLTVFTF
ENSCAFT00000027185_Canis_       SILR-----------------------------------------LGTLH---TITFFSL
ENSCAFT00000003068_Canis_       STMR-----------------------------------------TGALT---GGLAFTF
XM_001493317_Equus_             SILR-----------------------------------------LGPFH---IITLFSL
XM_001497663_Equus_             STMR-----------------------------------------TGFLA---PTSMFTF
BC151398_Bos.                   SFLR-----------------------------------------LGLKA---PLTLFTF
ENSBTAT00000021660_Bos_         SILR-----------------------------------------LGSQH---AITIFSL
BC119857_Bos_                   STMR-----------------------------------------TGFLA---PTSMFTF
XM_001376602_Monodelphis.       SFLR-----------------------------------------LGFQA---PTSLFTL
ENSMODT00000034227_Monodelphis_ TMAH-----------------------------------------LGFH----PITLFTL
XM_001367034_Monodelphis_       SILR-----------------------------------------AGFLA---PTSMFTF
ENSGALT00000016725_Gallus_      STMR-----------------------------------------TGFLA---PTSMFTF
XM_695024_Danio.                STVR-----------------------------------------QGFGA---PTSMFTF
BC139665_Danio.                 SVLR-----------------------------------------TGFMT---GTSLFTL
ENSDART00000074802_Danio_       SVLR-----------------------------------------LGPVQ---PITLFTF
ENSORLT00000021166_Oryzias.     SVLR-----------------------------------------AGFWT---STSLFTL
ENSORLT00000020354_Oryzias_     SVLR-----------------------------------------LGPVH---PITIFTL
ENSORLT00000014664_Oryzias_     STVR-----------------------------------------SGFSA---ATSMFTF
GSTENT00030235001_Tetraodon_    SVLRIG----DSKAVKPPGHLAGNLGVCKRRLDRFYIPSYSWCDLSGFWA---PTSLFTL
GSTENT00032293001_Tetraodon_    SVLR-----------------------------------------LGTSSFSVPRSSFCP
GSTENT00005617001_Tetraodon_    STVR-----------------------------------------TGFET---PTSMFTL
SINFRUT00000173110_Takifugu.    STVR-----------------------------------------SGFSA---ATSMFTF
SINFRUT00000147037_Takifugu.    SVLRIGREAAGSDAGEQPGHLFYIPGIL-HRLDRL----NSLCDGSGFWA---PTSLFPL
SINFRUT00000152743_Takifugu_    SVLR-----------------------------------------LGTSS-----SSFSP
SINFRUT00000155477_Takifugu_    STVR-----------------------------------------TGFET---PTSMFTL
                                :  :                                          *          *  

HIT000040995_Homo.          702 LVLLLTILVCLAHTCFGCFKHLSPLNYKTEEPASD-----------------------KG 738
HIT000045032_Homo_ [View]       STLLIAMVIAFVGIFLGKLRMVA--DYEPEEEEIQTVF--------------------DM
HIT000306225_Homo_ [View]       VVLVITIVICLCHVCFGHFKYLSAHNYKIEHTE-TDTV----------------DPRSNG
ENSPTRT00000003734_Pan.         LVLLLTILVCLAHTCFGCFKHLSPLNYKTEEPASD-----------------------KG
XR_024837_Pan_                  STLLIAMVIAFVGIFLGKLRMVA--DYEPEEEEIQTVF--------------------DM
XR_023256_Pan_                  VVLVITIVICLCHVCFGHFKYLSAHNYKIEHTE-TDTV----------------DPRSNG
ENSPPYT00000019366_Pongo_       VVLVITIVICLCHVCFGHFKYLSAHNYKIEHTE-TDTV----------------DPRSNG
XM_001089796_Macaca.            LVLLLTILVCLAHTCFGCFKHLSPLNYKTEEPASD-----------------------KG
XR_011678_Macaca_               STLLIAMLIAFAGIFLGKLRMVA--DYEPEEEEIQTVF--------------------DM
AK144899_Mus.                   LVVLLTILACLLYTCFGCFKHLSPWNYKTEESASD-----------------------KG
ENSMUST00000110185_Mus_         SSLIISVVIAFSGVFLGKLRIAQ--RYEQPEEETETVF--------------------DV
AK159673_Mus_                   VVLVITIVICLCHVCFGHFKYLSAHNYKIEHTE-TDAV----------------SSRSNG
ENSRNOT00000004519_Rattus.      LVALLAILACLLYTCFGCFKHLSPWNYKTEEPVGD-----------------------KR
XM_001061327_Rattus_            SSIIISVIIAFSGVFLGKFRIAQ--QYEQPEEETETVF--------------------DV
XM_001064906_Rattus_            VVLVITIVICLCHVCFGHFKYLSAHNYKIEHTE-TDAV----------------SSRSNG
XM_547510_Canis.                LVVLLTILVCLAYTCFGCFKHLSPHNYKTEDS-GD-----------------------KG
ENSCAFT00000027185_Canis_       STLIISMIIAFLSTLLGKLQRVS--DYEQPEEEMETVF--------------------DM
ENSCAFT00000003068_Canis_       VVLVITIVICLCHVCFGHFKYLSAHNYKIEHTE-TDAV----------------DPRSNG
XM_001493317_Equus_             STLVIAVIITFLASLMGKLQRVP--LYE-PEEEMETVY--------------------DM
XM_001497663_Equus_             VVLVITIVICLCHVCFGHFKYLSAHNYKIEHTE-TDIV----------------DPRSNG
BC151398_Bos.                   LVLLLTILVCLAYTCFGCFKHLSPLNYKTEESASD-----------------------KG
ENSBTAT00000021660_Bos_         TTLIVSIIMACVATFLGKMSKRT--NYEPQPEEMETVF--------------------DL
BC119857_Bos_                   VVLVITIVVCLCHVCFGHFKYLSAHNYKIEHTE-TDSV----------------DPRSNG
XM_001376602_Monodelphis.       LAVLLTIAVCIGYTCFGCFKHLSPLNYKTDESAND-----------------------KG
ENSMODT00000034227_Monodelphis_ TILFISIMISFANVCFGKFWRKEP-IYKRPEQKGESNC--------------------EI
XM_001367034_Monodelphis_       VVLVITIVISLCHLCFGYFKYFSAHNYKIEHTEGGDAA----------------DGRGNG
ENSGALT00000016725_Gallus_      VVLVITIVICLCHVCFGHFKYLSAHNYKIEHTE-VDTT----------------ESRQNG
XM_695024_Danio.                VVLIITIIICLSHIVFGHFKYLSAHNYKIDM-----------------------DGVDNG
BC139665_Danio.                 VVLCITVFICISYTCFGHFKYLSPHNYNVKEE-DEDA---------------------DI
ENSDART00000074802_Danio_       ITLLCSIAFSCFGFCMKKLRADRSTSYQ--------------------------------
ENSORLT00000021166_Oryzias.     VVLCVTVFICVGFTCFGHFKHLSPHNYTVSAQ-DEDTV--------------------EG
ENSORLT00000020354_Oryzias_     VSLISCIACCLFRLCLRKTPDKST-SYQMSDQPADATFT-------------------DA
ENSORLT00000014664_Oryzias_     VVLIITIVVCLSHVCFGHFKYLSAHNYKVQTPP-TQTDKPL-------------NVVENG
GSTENT00030235001_Tetraodon_    VVLCVTIFVAVSYTCFGHFKYLSPLNYEVKEEDDRDST----------------------
GSTENT00032293001_Tetraodon_    ALSVNVIASCVGSSC---------------------------------------------
GSTENT00005617001_Tetraodon_    VVLIVTIVVCLSHVCFGHFKYLSAHNYKVSLSPRAAAAARLTFCLCSDRHQGHGDGRCDG
SINFRUT00000173110_Takifugu.    IVLIITIIICLSHVCFGHFKYLSAHNYKIDSQDV--------------------DGLESG
SINFRUT00000147037_Takifugu.    VVLCVTILIAVGYTCFGHFKYLSPLSYEVKEE-DKDSS----------------------
SINFRUT00000152743_Takifugu_    AVSVNIVESCVESSR---------------------------------------------
SINFRUT00000155477_Takifugu_    VVLIITIVVCLSHVCFGHFKYLSAHNYK--------------------------------
                                      :                                                     

HIT000040995_Homo.          739 SEAEAHMPPP------FTPYVPRILNGLASERTALSPQQQQQQTYGAIHNISGTIPGQCL 792
HIT000045032_Homo_ [View]       EPSSTSSTPT------SLLYVATVLQEPELNLTPASSP--ARHTYGTMNNQPE--EGEEE
HIT000306225_Homo_ [View]       RPPTAAAVPK------SAKYIAQVLQDSEVDGDGDGAP--GS-----SGDEPPSSSSQDE
ENSPTRT00000003734_Pan.         SEAEAHMPPP------FTPYVPRILNGLASERTALSPQQRQQQTYGAIHNISGTIPGQCL
XR_024837_Pan_                  EPSSTSSTPT------SLLYVATVLQEPELNLTPASSP--ARHTYGTMNNQPE--EGEHE
XR_023256_Pan_                  RPPTAAAVPK------SAKYIAQVLQDSEVDGDGDGAP--GS-----SGDEPPSSSSQDE
ENSPPYT00000019366_Pongo_       RPPTVAAVPK------SAKYIAQVLQDSEVDGDGDGAP--GS-----SGDEPPSSSSQDE
XM_001089796_Macaca.            SEAEAHMPPP------FTPYVPRILNGLASERTALSPQ--QQQTYGAIHNISGTIPGQCL
XR_011678_Macaca_               EPSSTSSTPT------SLLYVATVLQEPELNLTPASSP--ARHTYGTMNNQPE--EGEEE
AK144899_Mus.                   SEAEAHVPPP------FTPYVPRILNGLASERTALSPQ--QQQTYGAIRNISGTLPGQPV
ENSMUST00000110185_Mus_         EPSSTTSTPT------SLLYVATVLQEPELNLTPASSP--ARHTYGTINSQPE--EGEEE
AK159673_Mus_                   RPPTAGAVPK------SAKYIAQVLQDSEGDGDGDGAP--GS-----SGDEPPSSSSQDE
ENSRNOT00000004519_Rattus.      NEAEAHAPPP------FTPYVPRILNGLTSERTALSPQ--QQQTYGAIRNISGTLPGQLV
XM_001061327_Rattus_            EPSSTTSTPT------SLLYVATVLQEPELNLTPASSP--ARHTYGTMNSQPE--EGEEE
XM_001064906_Rattus_            RPPTAGAVPK------SAKYIAQVLQDSEGDGDGDGAP--GS-----SGDEPPSSSSQDE
XM_547510_Canis.                SEAEAPRPAP------FTPYVPRILNGLSSERTALSPQ--QQQTYGAIHSISGTVPGQCP
ENSCAFT00000027185_Canis_       EPSSTSSTPT------SLMYVATVLQEPEMNLSPASSP--ARHTYGTMNRQLE--ESEEE
ENSCAFT00000003068_Canis_       RPPTAAAVPK------SAKYIAQVLQDSEVDGDGDGAP--GS-----SGDEPPLSSSQDE
XM_001493317_Equus_             EPSSTSSTPT------SLLYVATVLQEPEMNLTPASSP--ARHTYGTMNRQLE--EGEEE
XM_001497663_Equus_             RPPTAAAVPK------SAKYIAQVLQDSEV--DGDGGP--GS-----SGDEPPSSSSQDE
BC151398_Bos.                   NEAGAHVPPP------FTPYVPRILNSSSSEKTALSP---QQQTYGAINNISGTVAGQCL
ENSBTAT00000021660_Bos_         EPSSTSSTPT------SLLYVATVLQEPEMNLTPASSP--AQPTYGTMSRQPE--EGEEE
BC119857_Bos_                   RPPNAAAVPK------SAKYIAQVLQDSEV--DGDGGP--GS-----SGDEPPSSSSQDE
XM_001376602_Monodelphis.       SETDGRLPPR------AAMYVPRVLSSLASERTSLSPQ--DQQTYGAIQNISGTVPGQHS
ENSMODT00000034227_Monodelphis_ CPDMTSYSLSFLFSGWAQLYVAPVLQEMEMSLTPATSP--GRQSYGTMSSQLDALDVEEE
XM_001367034_Monodelphis_       ----ARSNVK------SAKYIAQVLQDSEEDRDSGDSG--GSRISEVSGAAPPLSLGHDE
ENSGALT00000016725_Gallus_      RPATNLPAPK------SAKYIAQVLQDS--------SP--EG-----EATESEEQGSQDE
XM_695024_Danio.                RLRGSSPPVKS-----MQTYIAQVLQDPNSDETGS---------------DQGQGSSQDE
BC139665_Danio.                 VSENSS----------GLVYLPKVLNPDASFESSDECS--PSHSYGTTDISPQFIGTEES
ENSDART00000074802_Danio_       ------------------LFIASVLLEPELGLTPMPSP--AHQSYGTMVNSQSSVRDAEE
ENSORLT00000021166_Oryzias.     VEENTRVIDS------YFVYLPRVLNPKSPVSTSQDPK--PPQCYGS-------------
ENSORLT00000020354_Oryzias_     DRSTVTSTTG------SSLFVASVLLEPELALTPMPSP--AHHSYGALSS----------
ENSORLT00000014664_Oryzias_     TAALETRPS-------KQMYIAEVLQDPEEAASGSS-------------EDEGQGPSRDE
GSTENT00030235001_Tetraodon_    EEEH------------TMVYLPRVLIPRSPDSTAHDSK--IHQTYGTTEESPICSASEEN
GSTENT00032293001_Tetraodon_    -----------------DLLQDRCIPSPSSTRWLCWPPLRCLWSTCALENNPISQRVTRS
GSTENT00005617001_Tetraodon_    ERMS------------GPAHLLTRRQTSDVHRSGAPGP--KHRGAGRCRRRRRRGGPELA
SINFRUT00000173110_Takifugu.    PSVCPSASNKA-----AQMYIAQVLQDPNSEEAGSGSG-----------EDDGQGSSQDE
SINFRUT00000147037_Takifugu.    GEEN------------TMVYLPRVLIPRSPDTTSPDSK--LHQSYGSAEDSPSCSASEDN
SINFRUT00000152743_Takifugu_    -----------------DLLQGCCIPSPSSTPFPCWPRLRCLSSACALENNPTSQ-----
SINFRUT00000155477_Takifugu_    ----------------QQMYIAQVLQDPNTEEPGG------------GSGEEDRTSSQDE
                                                                                            

HIT000040995_Homo.          793 AQSATGSVAAAP-----QEA--------------------------------------- 807
HIT000045032_Homo_ [View]       SGLRGFARELDSAQ--FQEGLELEGQNQYH-----------------------------
HIT000306225_Homo_ [View]       ELLMPPDALTDTD---FQSCEDSLIENEIH----------------------------Q
ENSPTRT00000003734_Pan.         AQSATGSVAAAP-----QEA---------------------------------------
XR_024837_Pan_                  SGLRGFARELDSDX--FQEGLELEGQNQYH-----------------------------
XR_023256_Pan_                  ELLMPPDALTDTD---FQSCEDSLIENEIH----------------------------Q
ENSPPYT00000019366_Pongo_       ELLMPPDGLTDTD---FQSCEDSLIENEIH----------------------------Q
XM_001089796_Macaca.            AQSSMGSVAAAP-----QEA---------------------------------------
XR_011678_Macaca_               SGLRGFARELDSAQ--FQEGLELEGQNQYH-----------------------------
AK144899_Mus.                   AQDPSGTAAYAY-----QES---------------------------------------
ENSMUST00000110185_Mus_         SGLRGFARELDSAQ--FQEGLEMEGQSH-------------------------------
AK159673_Mus_                   ELLMPPDGLTDTD---FQSCEDSLIENEIH----------------------------Q
ENSRNOT00000004519_Rattus.      AQDPSDTVAGVY-----QES---------------------------------------
XM_001061327_Rattus_            SGLRGFARELDPAQ--FQEGLELEGQSH-------------------------------
XM_001064906_Rattus_            ELLMPPDGLTDTD---FQSCEDSLIENEIH----------------------------Q
XM_547510_Canis.                AQGPGDSDSEPPV---YQEA---------------------------------------
ENSCAFT00000027185_Canis_       SCTRGFARELGSTQ--FQEGLELEGQSQYH-----------------------------
ENSCAFT00000003068_Canis_       ELLMPPDGLTDTD---FQSYEDSLIENEIH----------------------------Q
XM_001493317_Equus_             SGVRGFARELDSAK--FQEGLELEGQSQYH-----------------------------
XM_001497663_Equus_             ELLMPPDGLTDTD---FQSCEDSLIENEIH----------------------------Q
BC151398_Bos.                   AQSPEDRVAAAD-----QGD---------------------------------------
ENSBTAT00000021660_Bos_         SGVRAFSRELDSAR--FQEGLELGDQSQYH-----------------------------
BC119857_Bos_                   ELLMQPDGLTDTD---FQSCEDSLIENEIR----------------------------Q
XM_001376602_Monodelphis.       PKPSGFAPSLDA-----------------------------------------------
ENSMODT00000034227_Monodelphis_ SGPQSFSSEVGTAQGEFQEGLLMEGKDC-------------------------------
XM_001367034_Monodelphis_       ETLITQEELSDTD---FQSYVESLIENEIHPPVRRGGPGGSAPAPSPSSPTRPPRTLKR
ENSGALT00000016725_Gallus_      ELIT-TDGMNDTD---FQSCEDSLIENEIR----------------------------Q
XM_695024_Danio.                E------GVTEGD---FQSGEDSLIENEVH----------------------------Q
BC139665_Danio.                 SPDSDI-----------------------------------------------------
ENSDART00000074802_Danio_       DEEKDLEETLETE---LKDDLLMDSPVAFQ-----------------------------
ENSORLT00000021166_Oryzias.     -----------------------------------------------------------
ENSORLT00000020354_Oryzias_     -----------------------------------------------------------
ENSORLT00000014664_Oryzias_     EARRAENSMT-GD---FQSCEDSLIENEIR----------------------------Q
GSTENT00030235001_Tetraodon_    QADC-------------------------------------------------------
GSTENT00032293001_Tetraodon_    FPLR-------------------------------------------------------
GSTENT00005617001_Tetraodon_    AGGGANERREQHQRGRFPVRGGQSDR---------------------------------
SINFRUT00000173110_Takifugu.    EIINVQNGLN-AD---FQSGEDSLIDNEV------------------------------
SINFRUT00000147037_Takifugu.    QADC-------------------------------------------------------
SINFRUT00000152743_Takifugu_    -----------------------------------------------------------
SINFRUT00000155477_Takifugu_    EMMNGGNNINEAD---FQSGEDSLIANE-------------------------------