Alignment of orthologs
Amino acid abbreviation

[View by Jalview] (requires Java)

HIT000025795_Homo.            1 M-------EPSHKDAETAA----AAAAVAAADPRGASSSSGVVVQVREKKGPLRAAIPYM 49
XM_001141113_Pan.               M-------EPSHKDAETAA----AAAAVAAADPRGASSSSGVVVQVREKKGPLRAAIPYM
ENSPPYT00000000174_Pongo.       -----------------------------------XSSSSGVVVQVREKKGP-RAAIPYM
XM_001090058_Macaca.            M-------EPSHKDAETAA----AAAAVAAADPRGASSSSGVVVQVREKKGPLRAAIPYM
XM_001061318_Rattus.            M-------EPLHKDAETAA----AAAAVAAADPRGASSSSGVVVQVREKKGPLRAAIPYM
XM_849602_Canis.                M-------EPSHKDAETAA------AAAAAADPRAASSSSGVVVQVREKKGPLRAAIPYM
XM_001491484_Equus.             MGDLSGEGRGPKQPGAVGRGKRSWPLSKCSD---APRAFRRILEQATGQQSSQGETRSPD
BC134608_Bos.                   M-------EPSHKDAETAA----AAAAVAAAE-RGASSSSGVVVQVREKKGPLRAAIPYM
XM_001376966_Monodelphis.       M-------EHPHKDGETAAAATVAAATAAAADPRGTSSSSGVVVQVREKKGPLRAAIPYM
ENSGALT00000015006_Gallus.      -------------------------SAAGGEPSRGAAPSSGVVVQVREKKGPLRAAIPYM
NM_001030171_Danio.             M---------DQKDTEMNEKG-------------VSSSTSGVVVQVREKKGPLRAAIPYM
ENSORLT00000021422_Oryzias.     A------------------------DGADRRTNDAGKSGGGVVVEVREKKGSLRAAIPTM
GSTENT00020683001_Tetraodon.    M----------------------TPEGCCS----PPNTDRGVVVEVREKKGPLRAAIPTM
                                                                     .   :: :.  ::..   : .  

HIT000025795_Homo.           50 PFPVAVICLFLNTFVPGL------------------------------------------ 67
XM_001141113_Pan.               PFPVAVICLFLNTFVPGL------------------------------------------
ENSPPYT00000000174_Pongo.       PFPVAVICLFLNTFVPGL------------------------------------------
XM_001090058_Macaca.            PFPVAVICLFLNTFVPGL------------------------------------------
XM_001061318_Rattus.            PFPVAVICLFLNTFVPGL------------------------------------------
XM_849602_Canis.                PFPVAVICLFLNTLVPRL------------------------------------------
XM_001491484_Equus.             PRALGRVSDHAFLLVPHRG-----------------------------------------
BC134608_Bos.                   PFPVAVICLFLNTFVPGL------------------------------------------
XM_001376966_Monodelphis.       PFPVAVICLFLNTFVPGL------------------------------------------
ENSGALT00000015006_Gallus.      PFPVAVICLFLNTFVPGL------------------------------------------
NM_001030171_Danio.             PFPVAVICLFLNTFVPGL------------------------------------------
ENSORLT00000021422_Oryzias.     PFPLAVICLFLNTFIPGL------------------------------------------
GSTENT00020683001_Tetraodon.    PFPLAVICLFLNTFIPGLGESASAFGPSLSVGVCPDPTEKRRVRTSADSPRRTQGAVLRQ
                                * .:. :. .   ::*                                            

HIT000025795_Homo.              ------------------------------------------------------------
XM_001141113_Pan.               ------------------------------------------------------------
ENSPPYT00000000174_Pongo.       ------------------------------------------------------------
XM_001090058_Macaca.            ------------------------------------------------------------
XM_001061318_Rattus.            ------------------------------------------------------------
XM_849602_Canis.                ------------------------------------------------------------
XM_001491484_Equus.             ------------------------------------------------------------
BC134608_Bos.                   ------------------------------------------------------------
XM_001376966_Monodelphis.       ------------------------------------------------------------
ENSGALT00000015006_Gallus.      ------------------------------------------------------------
NM_001030171_Danio.             ------------------------------------------------------------
ENSORLT00000021422_Oryzias.     ------------------------------------------------------------
GSTENT00020683001_Tetraodon.    KPDQEAEPRGQARWVWVSGAQQNQRVLPQNQVPDPGSGSGVVVAAERSRQTVKTLAPDAE
                                                                                            

HIT000025795_Homo.           68 ------------GTFVSAFTVLCGARTDL-PDRHVCCVFWLNIAAALIQILTAIVMVGWI 114
XM_001141113_Pan.               ------------GTFVSAFTVLCGARTDL-PDRHVCCVFWLNIAAALIQILTAIVMVGWI
ENSPPYT00000000174_Pongo.       ------------GTFVSAFTVLCGARTDL-PDRHVCCVFWLNIAAALIQILTAIVMVGWI
XM_001090058_Macaca.            ------------GTFVSAFTVLCGARTDL-PDRHVCCVFWLNIAAALIQILTAIVMVGWI
XM_001061318_Rattus.            ------------GTFVSAFTVLCGARTDL-PDRHVCCVFWLNIAAALIQVLTAIVMVGWI
XM_849602_Canis.                ------------GTFVSAFAVLCGARTDL-PDRHVCCVFWLNIAAALIQTLTAIVMVGWI
XM_001491484_Equus.             ------------GTFVSAFAVLCGARTDL-PDRHVCCVFWLNVAAALIQVLTAIVMVGWI
BC134608_Bos.                   ------------GTFVSAFTVLCGARTDL-PDRHVCCVFWLNIAAALIQILTAIVMVGWI
XM_001376966_Monodelphis.       ------------GTFVSAFTVLCGARTDL-PDRHMCCVFWLNIAAALIQILTAIVMVGWI
ENSGALT00000015006_Gallus.      ------------GTFVSAFTVLCGARTDL-PDRHICCVFWLNIAAALIQILTAIVMVGWI
NM_001030171_Danio.             ------------GTFVSAFTVLCGARTDL-PDRHMCCVFWLNIAAAFIQIVTAVVMVGWI
ENSORLT00000021422_Oryzias.     ------------GTFLSAFTVLCGARSELISERGVCCVFWLNVAAALIQIVTAVIMVGWI
GSTENT00020683001_Tetraodon.    MRVILRKRKPVPGTLISAFTVLCGAQSELIPERGVCCVFWLNVAAAMIQILTAVIMVGWI
                                            **::***:*****:::* .:* :*******:***:** :**::*****

HIT000025795_Homo.          115 MSIFWGMDMVILAISQGYK-------EQGIPQQL 141
XM_001141113_Pan.               MSIFWGMDMVILAISQGYK-------EQGIPQQL
ENSPPYT00000000174_Pongo.       MSIFWGMDMVILAILTGYK-------EQGIPQQL
XM_001090058_Macaca.            MSIFWGMDMVILAISQGYK-------EQGIPQQL
XM_001061318_Rattus.            MSIFWGMDMVILAISQGYK-------DQAIPQQL
XM_849602_Canis.                MSIFWGMDMVILAISQGYK-------EQGIPQQL
XM_001491484_Equus.             MSIFWGMDMVILAISQGYK-------EQGVPQQL
BC134608_Bos.                   MSIFWGMDMVILAISQGYK-------EQGIPQQL
XM_001376966_Monodelphis.       MSIFWGMDMVILA---SYK-------EQGIPQQL
ENSGALT00000015006_Gallus.      MSIFWGMDMVILAIHTGSK-------EQGIPQQL
NM_001030171_Danio.             MSIFWGMDMVILA--KGYR-------EQSVPQQL
ENSORLT00000021422_Oryzias.     MSIFWGMDMVILANKYHIT-------ETNSPKYN
GSTENT00020683001_Tetraodon.    MSIFWGMDMVILASQFFFIPFSLRILSHSFPE-F
                                *************             .   *: