Alignment of orthologs
Amino acid abbreviation

[View by Jalview] (requires Java)

HIT000015863_Homo.            1 -MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSS-SPIQYEFSLTRET 58
ENSPTRT00000008133_Pan.         -MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSS-SPIQYEFSLTRET
CR861077_Pongo.                 -MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTTT-SPIQYEFSLTRET
U93310_Macaca.                  -MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTTS-SPIQYEFSLTRET
BC054436_Mus.                   -MNPAISVALLLSVLQVSRGQKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREK
X03150_Rattus.                  -MNPVISITLLLSVLQMSRGQRVISLTACLVNQNLRLDCRHENNTN-LPIQHEFSLTREK
XM_844606_Canis.                -MNPAIGFALLLTVLQVARGQKVTSLTACLVDQSLRLDCRHENATT-LPIQYEFSMTREK
EU881920_Equus.                 ------------------RGQKVTSLTACLADQSLRLDCRHENTTA-TPIQYEFSLTRET
BC104530_Bos.                   -MNPTIGIALLLTVLQVARGQKVTSLTACLVNQSLRLDCHHENTTT-TPIQYEFSLTRDT
XM_001380419_Monodelphis.       MLSPKIAIAVLLTVLQVAYGQKVNSLTACLVDKTLRVDCRFDNTSK-TPLQYEFSLTREK
                                                   **:* ******.::.**:**:.:* :   .:*:***:**:.

HIT000015863_Homo.           59 KKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQ 118
ENSPTRT00000008133_Pan.         KKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQ
CR861077_Pongo.                 KKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQ
U93310_Macaca.                  KKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTXKDEGTYTCXLHHSGHSPPISSQ
BC054436_Mus.                   RKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNK
X03150_Rattus.                  KKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNK
XM_844606_Canis.                KQHVIYGTVGVPEHSYRSRTNFTSKYNIKVLYLSGFTTKDEGTYTCELRLSGQPPITSSK
EU881920_Equus.                 KKHVLFGTVGVPEHTYRSRTSFTSKYNIKVLYLSSFTTKDEGLYTCELRLSGQPPVVSNK
BC104530_Bos.                   KKWVLSGSNGVTRPEYSSRTKFFSKYNLKVLYLSNFTTKDEGIYTCELRLSGPNPSVSNK
XM_001380419_Monodelphis.       QRHVLNSTMGVPEHAYRSRVNLTISQNYMALFLKDFSQKDEGIYACDLRASGIPNSFTTK
                                :: *: .: *:..  * **..:  .    .* *  *: **** * * *: **     :.:

HIT000015863_Homo.          119 NVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL 161
ENSPTRT00000008133_Pan.         NVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
CR861077_Pongo.                 NVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
U93310_Macaca.                  NVTVLRDKLVKCEGISLLAQNTSWLXLLLLSLSLLQATDFMSL
BC054436_Mus.                   SISVYRDKLVKCGGISLLVQNTSWMLLLLLSLSLLQALDFISL
X03150_Rattus.                  TINVIRDKLVKCGGISLLVQNTSWLLLLLLSLSFLQATDFISL
XM_844606_Canis.                NVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLPLLQAMDFISL
EU881920_Equus.                 TVSVLRDKLVKCEGISLLAQNTSRLLLLLLSLPLL--------
BC104530_Bos.                   DVSVLRDKLVRCGGISLLIQNTSWLLLLLLSLPLLQAMDFISL
XM_001380419_Monodelphis.       NITVYKDKLQTCGVMSLLVQNTSWLLLLLLSVPLLQATNFECL
                                 :.* :***  *  :*** **** : *****:.:*