Alignment of orthologs
Amino acid abbreviation [ Alignment of gene family/group ]

[View by Jalview] (requires Java)

HIT000013556_Homo.            1 ----MDYKSSLIQD-------GNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCAN 49
XM_524625_Pan.                  ----MDYKSSLIQD-------GNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCAN
ENSPPYT00000002021_Pongo.       ----MDYKSSLIQD-------GNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCAN
XM_001108306_Macaca.            ----MDYKSSLIQD-------GNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCAN
DQ229108_Mus.                   ----MDYKSGLIPD-------GNAMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCAN
BC061824_Rattus.                ----MDYKSGLIPD-------GNAMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCAN
XM_544488_Canis.                ----MDYKSSLIQD-------GNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCAN
ENSECAT00000026380_Equus.       ----MDYKSSLIQD-------GNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCAN
BC112721_Bos.                   ----MDYKSSLIQD-------GNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCAN
XM_001369455_Monodelphis.       ----MDYKSGLIQD-------SNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCAN
BX931246_Gallus.                ----MDFQPSILRD-------GSPMESLEKQLLCPICLEMFSKPVVILPCQHNLCRKCAN
BC049414_Danio.                 MD--IQRTASLLGT-------PDSMEGLEKQLSCPICLDMFTKPVVILPCQHNLCRGCAS
BC075897_Danio.                 MSVTLDY--CLSRS-------RDTMESLERQLICPICLEIFTKPVVILPCQHNLCRKCAN
ENSORLT00000010271_Oryzias.     ----VQRTGSIVRP-------PSPMDSLEKQLSCPICLEMFTKPVVILPCQHNLCRSCAS
CR670382_Tetraodon.             MNFALGCKPPSAGSSGPGAPRGTAMENLEKQLVCPVCLEMFSKPVVILPCQHNLCRKCAS
SINFRUT00000155215_Takifugu.    ------------------------MDNLEKQLICPICLEMFTKPVVILPCQHNLCRKCAN
                                                        *:.**:** **:**::*:************** **.

HIT000013556_Homo.           50 DIF-QAANPYWTSRGSSV-SMSGGRFRCPTCRHEVIMDRHGVYGLQRNLLVENIIDIYKQ 107
XM_524625_Pan.                  DIF-QAANPYWTSRGSSV-SMSGGRFRCPTCRHEVIMDRHGVYGLQRNLLVENIIDIYKQ
ENSPPYT00000002021_Pongo.       DIF-QAANPYWTSRGSSV-SMSGGRFRCPTCRHEVIMDRHGVYGLQRNLLVENIIDIYKQ
XM_001108306_Macaca.            DIF-QAANPYWTGRGSSV-SMSGGRFRCPTCRHEVIMDRHGVYGLQRNLLVENIIDIYKQ
DQ229108_Mus.                   DIF-QAANPYWTNRGGSV-SMSGGRFRCPSCRHEVIMDRHGVYGLQRNLLVENIIDIYKQ
BC061824_Rattus.                DIF-QAANPYWTNRGGSV-SMSGGRFRCPSCRHEVIMDRHGVYGLQRNLLVENIIDIYKQ
XM_544488_Canis.                DIF-QAANPFWTNRVGSV-SMSGGRFRCPSCRHEVIMDRHGVYGLQRNLLVENIIDIYKQ
ENSECAT00000026380_Equus.       DIF-QAANPYWTNRSGSV-SVSGGRFRCPSCRHEVIMDRHGVYGLQRNLLVENIIDIYKQ
BC112721_Bos.                   DIFQQAANPYWTGRVGSA-AMSGGRFRCPSCRHEVIMDRHGVYGLQRNLLVENIIDIYKQ
XM_001369455_Monodelphis.       DVF-QAANPYWSNRGGSI---SGGRFRCPSCRHEVIMDRHGVYGLQRNLLVENIIDIYKQ
BX931246_Gallus.                DIF-QAANPYWQSRGSS--IISGARFRCPTCRHEVLLDRHGVYGLQRNLLVENIIDIYKQ
BC049414_Danio.                 DLY-DSRNPY---------RFSGGVFRCPTCRFEVVLDRHGVHGLQRNLLVENIIDIYKQ
BC075897_Danio.                 DIF-QASNPYLPTRGGSS-LGSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDMYKQ
ENSORLT00000010271_Oryzias.     DLY-DSRNPY---------RYSGGVFRCPTCRFEVVLDRHGVHGLQRNLLVENIIDIYKQ
CR670382_Tetraodon.             DIF-QEANHLGHSRGSSAAVLSGSRFRCPSCRHEVVLDRHGIYGLQRNLLVENIIDVYRQ
SINFRUT00000155215_Takifugu.    DIF-QASNPYLPTRAGS--LTSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDMFKQ
                                *:: :  *             **. ****:**.**::****::*************:::*

HIT000013556_Homo.          108 ECS---------S-RPL--QKGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACE 155
XM_524625_Pan.                  ECS---------S-RPL--QKGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACE
ENSPPYT00000002021_Pongo.       ECS---------S-RPL--QKGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACE
XM_001108306_Macaca.            ECS---------S-RPL--QKGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGVHKACE
DQ229108_Mus.                   ECS---------S-RPL--QKGSHPMCKEHEDEKINIYCLTCEVPTCSLCKVFGAHQACE
BC061824_Rattus.                ECS---------S-RPL--QKGSHPMCKEHEDEKINIYCLTCEVPTCSLCKVFGAHQACE
XM_544488_Canis.                ECS---------S-RPL--QKGSHPMCKEHEDEKINIYCLTCEMPTCSMCKVFGAHKACE
ENSECAT00000026380_Equus.       ECS---------S-RPL--QKGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGAHQACE
BC112721_Bos.                   ECS---------S-RPL--QKGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGAHKACE
XM_001369455_Monodelphis.       ECS---------S-RPL--QKGNHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGAHKACE
BX931246_Gallus.                EFS---------S-RPL--KKGEHPMCKEHEDERINIYCVTCEVPTCSMCKVFGAHKDCE
BC049414_Danio.                 QQEGGGGGGGSTTESPIKPKSSKELMCQEHEDEKINIYCVTHQTPTCSMCKVFGQHKDCE
BC075897_Danio.                 ESS---------SSKPEPQVKEEVLMCEEHQDERINIYCVTCSVPTCSLCKVFGSHQTCE
ENSORLT00000010271_Oryzias.     QQEGRNSG---DTETSLKTKESKEPMCQEHDDERINIYCVTCQVPTCSMCKVFGQHKDCE
CR670382_Tetraodon.             QEA--------ARLVAMKPKQPQQLLCEDHEDEKINIYCLSCQTPTCSMCKVFGKHKDCD
SINFRUT00000155215_Takifugu.    ESS---------SGKPVEERKEQMPMCDVHEGEKINIYCITHAVPTCSMCKIFGAHKDCE
                                :              .    . .  :*. *:.*:*****::   ****:**:** *: *:

HIT000013556_Homo.          156 VAPLQSVFQGQKTELNNCISMLVAGNDRVQTIITQLEDSRRVTKENSHQVKEELSQKFDT 215
XM_524625_Pan.                  VAPLQSVFQGQKTELNNCISMLVAGNDRVQTIITQLEDSRRVTKENSHQVKEELSQKFDT
ENSPPYT00000002021_Pongo.       VAPLQSVFQGQKTELNNCISMLVAGNDRVQTIITQLEDSCRVTKENSHQVKEELSQKFDT
XM_001108306_Macaca.            VAPLQSVFQGQKIELNNCISMLVAGNDRVQTIITQLEDSCRVTKENSHQVKEELSQKFDT
DQ229108_Mus.                   VAPLQSIFQGQKTELSNCISMLVAGNDRVQTIISQLVDSCRVTKENSHQVKEELSQKFDT
BC061824_Rattus.                VAPLQSIFQGQKTELSNCISMLVAGNDRVQTIISQLEDSCRVTKENSHQVKEELSHKFDA
XM_544488_Canis.                VAPLQSVFQGQKTELSNCISMLVAGNDRMQTIITQLEDSCRVTKENSHHVKEELSQKFDV
ENSECAT00000026380_Equus.       VAPLQSVFQGQKTELSNCVSMLVAGNDRVQTIITQLEDSCRVTKENSRQVKEELSRKFDA
BC112721_Bos.                   VAPLQSVFQGQKTELSNCISMLVAGNDRVQTIITQLEDSCRVTKENSHQVKEELSQKFDT
XM_001369455_Monodelphis.       VAPLQNVFQGQKTELSNCISMLVAGNDRVQTIITQLEDSCRVTKENSHQVKEELSEKFDV
BX931246_Gallus.                VAPLQSIFQGQKSELNNCISMLVAGNDRIQTIISQLEDSCRSTEENSEAAKQELCARFDA
BC049414_Danio.                 VSPLASVYQAQKGELSNAIDALVAGNGRLQALLNQMEEACTAVQDNAQRAKQKFGECFDS
BC075897_Danio.                 VAPLKSVYESQKTELSDGVGLLVGNNDRIQGIISQLEETCRSVEENGRRQKSRVCEWFDR
ENSORLT00000010271_Oryzias.     VAPLETVYQTQKGELSNAIDTLVASNARLQALLNQMDDACRAVQDNAQTAKQGLAERFDL
CR670382_Tetraodon.             GAPLDNVYFRTKTELSDGIAVLVAKHDHVQEHISQMEDMCRTIEENGKQQQEQLAGRFYR
SINFRUT00000155215_Takifugu.    VSPITSIYQTKKMELSDGIAMMVGNNDRMQGIISQLEETCRAIEENGRRQKTMVCEKFDQ
                                 :*: .::   * **.: :  :*. : ::*  :.*: :     ::*..  :  .   *  

HIT000013556_Homo.          216 LYAILDEKKSELLQRITQEQEKKLSFIEALIQQYQEQLDKSTKLVETAIQSLDEPGGATF 275
XM_524625_Pan.                  LYAILDEKKSELLQRITQEQEEKLSFIEALIQQYQEQLDKSTKLVETAIQSLDEPGGATF
ENSPPYT00000002021_Pongo.       LYAILDEKKSELLQRITQEQEEKLSFIEALIQQYQEQLDKSTKLMETAIQSLDEPGGATF
XM_001108306_Macaca.            LYAILDEKKSELLQRITQEQEEKLSFIEALIQQYQEQLDKSTKLVETAIQSLDEPGGATF
DQ229108_Mus.                   LYAILDEKKSELLQRITQEQEEKLGFIEALILQYREQLEKSTKLVETAIQSLDEPGGATF
BC061824_Rattus.                LYAILDEKKSELLQRITQEQEEKLDFIEALILQYREQLEKSTKLVETAIQSLDEPGGATF
XM_544488_Canis.                LYAILDEKKSELLQRITREQEDKLSFIEGLIQQYREQLDKSTKLVETAIQSLDEPGGAIF
ENSECAT00000026380_Equus.       LYAILDEKKSELLQRITQEQEEKLSFIEALIQQYREQLDKSTKLVETAIQSLDEPGGAIF
BC112721_Bos.                   LYAILDEKKSELLQRITREQEEKLGFLEALIQQYREQLDKSTKLVETAIQSLDEPGGAIF
XM_001369455_Monodelphis.       LYAILDEKKSELLQRITREQEEKISFIEALIQQYREQLEKATKLVETAIQSMDEPGGAAF
BX931246_Gallus.                FSALLEEKKTELLGRITREQEDKTSFVQGLIHKYKEQLEKSSRLVETAIQAMEETGGAAF
BC049414_Danio.                 LYAALEERKNALLERIGKEQDEKVGALRSLARRYGDRLQAATELTDMAVQALEQSGAAEF
BC075897_Danio.                 LYALLEERRGDLTLKITAEQQEKLDYISGLQRKYREHLDNSAKLVETGIQTMEESEMAIF
ENSORLT00000010271_Oryzias.     LYAILEERKAILLEQIGKEQDEKVAALRALAQRYGERLQASTELTDSAVRALEQNGAAEF
CR670382_Tetraodon.             LVVTLEERKQELVGLISKEQDHKLKRARSLLRRYREQLEAAVALVESAIRSMEEPHMSAF
SINFRUT00000155215_Takifugu.    LYSVLEEKKREMSQKVTDEQEEKLSYIRSLTRKYGDHLEQSCKVVEMGIQNMEEPEMALF
                                :   *:*::  :   :  **:.*     .*  :* ::*: :  : : .:: :::   : *

HIT000013556_Homo.          276 -----------------LLTAKQLIKSIVEASKGC-QLGKTEQGFENMDFFTLDLEHIAD 317
XM_524625_Pan.                  -----------------LLTAKQLIKSIVEASKGC-QLGKTEQGFENMDFFTLDLEHIAD
ENSPPYT00000002021_Pongo.       -----------------LLTAKQLIKSIVEASKGC-QLGKTEQGFENMDCFTLDLEHIAD
XM_001108306_Macaca.            -----------------LLTAKQLIKSIVEASKGC-QLGKTEQGFENMDFFTLNLEHIAD
DQ229108_Mus.                   -----------------LSSAKQLIKSNVEASKGC-QLGKTEQGFENMDYFTLDLEHIAE
BC061824_Rattus.                -----------------LLSAKPLIKSIVEASKGC-QLGKTEQGFENMDYFTLNLEHIAE
XM_544488_Canis.                -----------------LLSAKQLIKSIVEASKGC-QLGKTEQGFENMDYFTLDLEHIAN
ENSECAT00000026380_Equus.       -----------------LLSAKKLIKSIVEASKGC-QLGKTEQGFENMDYFTLDLEHIAD
BC112721_Bos.                   -----------------LLSAKQLIRSIVEASKGC-QLGKIEQGFENMDYFTLDLEHVAD
XM_001369455_Monodelphis.       -----------------LMNAKPLIKAIVEASKGC-HLGKTEQGFENMDYFTLDLEHIAD
BX931246_Gallus.                -----------------LMNAKQLIKTIVEASKGG-RLEKIEQGYENMDAFTVSLEHLAD
BC049414_Danio.                 -----------------LQASKNLISQTKDAAKSSLAEERPEPGFERMDHFTLDTEQVET
BC075897_Danio.                 -----------------LQNTKPLLQQIAESRNVS-HLEKVERGYENMDHFSANFQSERR
ENSORLT00000010271_Oryzias.     -----------------LLLSKGLITQTKDAAKSSLGEERPEPGFEKMDHFTLSTEHVET
CR670382_Tetraodon.             -----------------IQSANVILERMAAASRTS-STERPELGYENMNHFTVDTEEAAA
SINFRUT00000155215_Takifugu.    LQECRNSMKNVSYFFCLLQNTKPLLKKITDATSTA-HLDKVERGYENMDHFHVEFKKVGQ
                                                 :  :: ::     :        : * *:*.*: *  . :    

HIT000013556_Homo.          318 ALRAIDFGTDEEEEEFI---EEEDQEEEESTEGK-------------------------- 348
XM_524625_Pan.                  ALRAIDFGTDEEEEEFI---EEEDQEEEESTEGK--------------------------
ENSPPYT00000002021_Pongo.       ALRAIDFGTDEEEEEFI---EEEDQEEEDSTEGK--------------------------
XM_001108306_Macaca.            ALRAIDFGTDEEEEEFI---EEEDQEEEGSTEGK--------------------------
DQ229108_Mus.                   ALRAIDFGTDEEEEEFT--EEEADEEEGVTTEGH--------------------------
BC061824_Rattus.                ALRAIDFGTD-EEEEFTEEEEEEDQEEGVSTEGH--------------------------
XM_544488_Canis.                TLRAIDFGTDEEEEEFI--EEEEDQEEEESTERK--------------------------
ENSECAT00000026380_Equus.       TLRAIDFGTDEEEEEFF---EEEDQEEEESTEGK--------------------------
BC112721_Bos.                   TLRTIDFGTDEEEEEFI--QEEEDHEEEESTEGK--------------------------
XM_001369455_Monodelphis.       TLRAIDFGSDEEEEEFIEAEGDEDEQEEEDLSGG--------------------------
BX931246_Gallus.                AVRALDFEPDEEDEFYEEVEEDTGDTEPESVVAA--------------------------
BC049414_Danio.                 LLSKMDFGGEDDEEFEDAEDQEEE------------------------------------
BC075897_Danio.                 AILSIDFIKDGDDNDEDEDDDEEITVNPEASSGAAPAPVQQRQTPVPNPSPMAADSVQMS
ENSORLT00000010271_Oryzias.     LLAKMDFGVADDEDFEDAEEEEDSGGVKLNHE----------------------------
CR670382_Tetraodon.             ALQSLHFCSGVEEDEE-AEEDSEVNVPSSSTVGQ--------------------------
SINFRUT00000155215_Takifugu.    ALRSID------------------------------------------------------
                                 :  :.                                                      

HIT000013556_Homo.          349 ----EEGHQ--------------------------------------------------- 353
XM_524625_Pan.                  ----EEGHQ---------------------------------------------------
ENSPPYT00000002021_Pongo.       ----EEGHQ---------------------------------------------------
XM_001108306_Macaca.            ----EEGHQ---------------------------------------------------
DQ229108_Mus.                   ----Q-------------------------------------------------------
BC061824_Rattus.                ----Q-------------------------------------------------------
XM_544488_Canis.                ----EEGHQ---------------------------------------------------
ENSECAT00000026380_Equus.       ----EEGRK---------------------------------------------------
BC112721_Bos.                   ----EEGHQ---------------------------------------------------
XM_001369455_Monodelphis.       ----EDGRTTGTGPRVVHTAVQGRSRRSLQPVPLHLTSPTPPTHTPPRGSLHTTHQLQRF
BX931246_Gallus.                ----PQ------------------------------------------------------
BC049414_Danio.                 ------------------------------------------------------------
BC075897_Danio.                 LKPSQSANTNPTENTPIVTPTPDSTHIPSADAQAQVTSGPGQTSDDGQRHVFSFSWLNMP
ENSORLT00000010271_Oryzias.     ------------------------------------------------------------
CR670382_Tetraodon.             ----QSFLAPPLNSSSVFTVVNKSKYTK--------------------------------
SINFRUT00000155215_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000013556_Homo.              ------------------
XM_524625_Pan.                  ------------------
ENSPPYT00000002021_Pongo.       ------------------
XM_001108306_Macaca.            ------------------
DQ229108_Mus.                   ------------------
BC061824_Rattus.                ------------------
XM_544488_Canis.                ------------------
ENSECAT00000026380_Equus.       ------------------
BC112721_Bos.                   ------------------
XM_001369455_Monodelphis.       SRALAVRRKSAVSPGRGR
BX931246_Gallus.                ------------------
BC049414_Danio.                 ------------------
BC075897_Danio.                 K-----------------
ENSORLT00000010271_Oryzias.     ------------------
CR670382_Tetraodon.             ------------------
SINFRUT00000155215_Takifugu.    ------------------