Alignment of orthologs
Amino acid abbreviation [ Alignment of gene family/group ]

[View by Jalview] (requires Java)

HIT000004639_Homo.              ------------------------------------------------------------
XR_019694_Pan.                  ------------------------------------------------------------
CR858910_Pongo.                 ------------------------------------------------------------
XM_001104518_Macaca.            ------------------------------------------------------------
BC055809_Mus.                   ------------------------------------------------------------
XM_343995_Rattus.               ------------------------------------------------------------
XM_544799_Canis.                MAVMLYIALVRDTEAGSGTVDKGPLTKPKSLHVAFRRSEVQDRLASGLVSGKGCLPGLQV
XM_001499808_Equus.             ------------------------------------------------------------
BC104514_Bos.                   ------------------------------------------------------------
ENSMODT00000021501_Monodelphis. ------------------------------------------------------------
AJ851748_Gallus.                ------------------------------------------------------------
BC067142_Danio.                 ------------------------------------------------------------
NM_001123297_Danio.             ------------------------------------------------------------
ENSORLT00000019887_Oryzias.     ------------------------------------------------------------
CR722600_Tetraodon.             ------------------------------------------------------------
SINFRUT00000145644_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000004639_Homo.              ------------------------------------------------------------
XR_019694_Pan.                  ------------------------------------------------------------
CR858910_Pongo.                 ------------------------------------------------------------
XM_001104518_Macaca.            ------------------------------------------------------------
BC055809_Mus.                   ------------------------------------------------------------
XM_343995_Rattus.               ------------------------------------------------------------
XM_544799_Canis.                AFLVLWEGKSPWTNKYDRGLRLSLTQWPELRDYRAVLGVRQRPWASAPAGRAGDTALLHQ
XM_001499808_Equus.             ------------------------------------------------------------
BC104514_Bos.                   ------------------------------------------------------------
ENSMODT00000021501_Monodelphis. ------------------------------------------------------------
AJ851748_Gallus.                ------------------------------------------------------------
BC067142_Danio.                 ------------------------------------------------------------
NM_001123297_Danio.             ------------------------------------------------------------
ENSORLT00000019887_Oryzias.     ------------------------------------------------------------
CR722600_Tetraodon.             ------------------------------------------------------------
SINFRUT00000145644_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000004639_Homo.              ------------------------------------------------------------
XR_019694_Pan.                  ------------------------------------------------------------
CR858910_Pongo.                 ------------------------------------------------------------
XM_001104518_Macaca.            ------------------------------------------------------------
BC055809_Mus.                   ------------------------------------------------------------
XM_343995_Rattus.               ------------------------------------------------------------
XM_544799_Canis.                GRPRTDERRARAWEGPLAFGGLPGRGLGRRGSLSFATLRPAARPACTSSPSRPRRPGSRR
XM_001499808_Equus.             ------------------------------------------------------------
BC104514_Bos.                   ------------------------------------------------------------
ENSMODT00000021501_Monodelphis. ------------------------------------------------------------
AJ851748_Gallus.                ------------------------------------------------------------
BC067142_Danio.                 ------------------------------------------------------------
NM_001123297_Danio.             ------------------------------------------------------------
ENSORLT00000019887_Oryzias.     ------------------------------------------------------------
CR722600_Tetraodon.             ------------------------------------------------------------
SINFRUT00000145644_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000004639_Homo.              ------------------------------------------------------------
XR_019694_Pan.                  ------------------------------------------------------------
CR858910_Pongo.                 ------------------------------------------------------------
XM_001104518_Macaca.            ------------------------------------------------------------
BC055809_Mus.                   ------------------------------------------------------------
XM_343995_Rattus.               ------------------------------------------------------------
XM_544799_Canis.                ELSLLPVHGRVMSPRPPGEPLGRGAVAGRVWERLAGSPGRSGPGRREPPQPWLTDFVAGK
XM_001499808_Equus.             ------------------------------------------------------------
BC104514_Bos.                   ------------------------------------------------------------
ENSMODT00000021501_Monodelphis. ------------------------------------------------------------
AJ851748_Gallus.                ------------------------------------------------------------
BC067142_Danio.                 ------------------------------------------------------------
NM_001123297_Danio.             ------------------------------------------------------------
ENSORLT00000019887_Oryzias.     ------------------------------------------------------------
CR722600_Tetraodon.             ------------------------------------------------------------
SINFRUT00000145644_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000004639_Homo.              ------------------------------------------------------------
XR_019694_Pan.                  ------------------------------------------------------------
CR858910_Pongo.                 ------------------------------------------------------------
XM_001104518_Macaca.            ------------------------------------------------------------
BC055809_Mus.                   ------------------------------------------------------------
XM_343995_Rattus.               ------------------------------------------------------------
XM_544799_Canis.                FRQHRGSGLCLRHISGASFKRFRRPGWFHDRGWHHLREACSFTCLVPRLDNVKNGAGAEH
XM_001499808_Equus.             ------------------------------------------------------------
BC104514_Bos.                   ------------------------------------------------------------
ENSMODT00000021501_Monodelphis. ------------------------------------------------------------
AJ851748_Gallus.                ------------------------------------------------------------
BC067142_Danio.                 ------------------------------------------------------------
NM_001123297_Danio.             ------------------------------------------------------------
ENSORLT00000019887_Oryzias.     ------------------------------------------------------------
CR722600_Tetraodon.             ------------------------------------------------------------
SINFRUT00000145644_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000004639_Homo.              ------------------------------------------------------------
XR_019694_Pan.                  ------------------------------------------------------------
CR858910_Pongo.                 ------------------------------------------------------------
XM_001104518_Macaca.            ------------------------------------------------------------
BC055809_Mus.                   ------------------------------------------------------------
XM_343995_Rattus.               ---------------------------------MPEVGNGETEDRASTGALLNSWRIPKL
XM_544799_Canis.                SCVAPPCVLASSQHAGSWVVGLSYRVAQDSRKKEKRIHSETLDDVETLGILPTVECGGGQ
XM_001499808_Equus.             ------------------------------------------------------------
BC104514_Bos.                   ------------------------------------------------------------
ENSMODT00000021501_Monodelphis. ------------------------------------------------------------
AJ851748_Gallus.                ------------------------------------------------------------
BC067142_Danio.                 ------------------------------------------------------------
NM_001123297_Danio.             ------------------------------------------------------------
ENSORLT00000019887_Oryzias.     ------------------------------------------------------------
CR722600_Tetraodon.             ------------------------------------------------------------
SINFRUT00000145644_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000004639_Homo.              ------------------------------------------------------------
XR_019694_Pan.                  ------------------------------------------------------------
CR858910_Pongo.                 ------------------------------------------------------------
XM_001104518_Macaca.            ------------------------------------------------------------
BC055809_Mus.                   ------------------------------------------------------------
XM_343995_Rattus.               QKEEKLGQRERADCKAAWRMGKGVLKGHETFDIVYLRKDGAESSELEFTLSGFLPVSQEH
XM_544799_Canis.                DKVKDSDSRTFNQAQDPMASTNLTPMKAALKRVQFGMKKLRSSDLLCVTQQDIVRTGKRS
XM_001499808_Equus.             ------------------------------------------------------------
BC104514_Bos.                   ------------------------------------------------------------
ENSMODT00000021501_Monodelphis. ------------------------------------------------------------
AJ851748_Gallus.                ------------------------------------------------------------
BC067142_Danio.                 ------------------------------------------------------------
NM_001123297_Danio.             ------------------------------------------------------------
ENSORLT00000019887_Oryzias.     ------------------------------------------------------------
CR722600_Tetraodon.             ------------------------------------------------------------
SINFRUT00000145644_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000004639_Homo.              ------------------------------------------------------------
XR_019694_Pan.                  ------------------------------------------------------------
CR858910_Pongo.                 ------------------------------------------------------------
XM_001104518_Macaca.            ------------------------------------------------------------
BC055809_Mus.                   ------------------------------------------------------------
XM_343995_Rattus.               VGKERDSSEQQGKRGSGFTCAGGQHNQANQAPCGFTSRLPRQPWSGRVATRSREERAAFE
XM_544799_Canis.                NSFGLFSDVTKTTEPYYLLSFYNAEYVSHGNASTVSQSLPHCPNKHNLRPGLRKLGELRM
XM_001499808_Equus.             ------------------------------------------------------------
BC104514_Bos.                   ------------------------------------------------------------
ENSMODT00000021501_Monodelphis. ------------------------------------------------------------
AJ851748_Gallus.                ------------------------------------------------------------
BC067142_Danio.                 ------------------------------------------------------------
NM_001123297_Danio.             ------------------------------------------------------------
ENSORLT00000019887_Oryzias.     ------------------------------------------------------------
CR722600_Tetraodon.             ------------------------------------------------------------
SINFRUT00000145644_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000004639_Homo.              ------------------------------------------------------------
XR_019694_Pan.                  ------------------------------------------------------------
CR858910_Pongo.                 ------------------------------------------------------------
XM_001104518_Macaca.            ------------------------------------------------------------
BC055809_Mus.                   ------------------------------------------------------------
XM_343995_Rattus.               VRAALRLQTRNAQACSQSAQAPPRSDFSKKCLSSRSPEHRGRVHGSLAEPRPPQVVLGDP
XM_544799_Canis.                AFDGLEIKCAQARAPNTQAPPTSDFSESVLVAGHLSSGASAAGGFATPALRGPARRPALA
XM_001499808_Equus.             ------------------------------------------------------------
BC104514_Bos.                   ------------------------------------------------------------
ENSMODT00000021501_Monodelphis. ------------------------------------------------------------
AJ851748_Gallus.                ------------------------------------------------------------
BC067142_Danio.                 ------------------------------------------------------------
NM_001123297_Danio.             ------------------------------------------------------------
ENSORLT00000019887_Oryzias.     ------------------------------------------------------------
CR722600_Tetraodon.             ------------------------------------------------------------
SINFRUT00000145644_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000004639_Homo.            1 ----------------------------------------MASLFKKKTVDDVIKEQNRE 20
XR_019694_Pan.                  ----------------------------------------MASLFKKKTVDDVIKEQNRE
CR858910_Pongo.                 ----------------------------------------MASLFKKKTVDDVIKEQNRE
XM_001104518_Macaca.            ----------------------------------------MACLFKKKTVDDVIKEQNRE
BC055809_Mus.                   ----------------------------------------MASLFKKKTVDDVIKEQNRE
XM_343995_Rattus.               VFLLLPLRASPGICPSTRPSPRTGPDRTGPSWAARTRPLTMASLFKKKTVDDVIKEQNRE
XM_544799_Canis.                ACPSPRRRSGPSAGPSPPSCPLPAAGGTGRSRAARARPLTMASLFKKKTVDDVIKEQNRE
XM_001499808_Equus.             ----------------------------------------MKRVM--IALKDVIKEQNRE
BC104514_Bos.                   ----------------------------------------MASLFKKKTVDDVIKEQNRE
ENSMODT00000021501_Monodelphis. ----------------------------------------MASLFKKKTVDDVIKEQNRE
AJ851748_Gallus.                ----------------------------------------MASLFKKKTVDDIIKEQNRE
BC067142_Danio.                 ----------------------------------------MTSLFKKKTVDDVIKEQNKE
NM_001123297_Danio.             ----------------------------------------MASLFKKKTVDDIIKEQSKE
ENSORLT00000019887_Oryzias.     ----------------------------------------MASLFKKKTVDDIIKEQSKE
CR722600_Tetraodon.             ----------------------------------------MASLFKKKTVDDIIREQSRE
SINFRUT00000145644_Takifugu.    ----------------------------------------MASLFKKKTVDDIIKEQSRE
                                                                        *  ::   ::.*:*:**.:*

HIT000004639_Homo.           21 LRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSS 80
XR_019694_Pan.                  LRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSS
CR858910_Pongo.                 LRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSS
XM_001104518_Macaca.            LRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQLVHLRKQKTRTFAVSS
BC055809_Mus.                   LRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQLVHLRKQKTRTFAVSS
XM_343995_Rattus.               LRGTQRAIIRDRAALEKQEKQL--------------------------------------
XM_544799_Canis.                LRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQLVHLRKQKTRTFAVSS
XM_001499808_Equus.             LRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQLVHLRKQKTRTFAVSS
BC104514_Bos.                   LRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQLVHLRKQKTRTFAVSS
ENSMODT00000021501_Monodelphis. LRGTQRAIMRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQLVQLRKQKTRTFAVSS
AJ851748_Gallus.                LRGTQRTITRDRAALEKQERQLELEIKKMAKTGNKEACKVLAKQLVQLRKQKNRTYAVSS
BC067142_Danio.                 LRGTQRQIARDRTALEKQEKQLEMEIKKMAKTGNRDACKVLAKQLVQVRKQKTRTYAVSS
NM_001123297_Danio.             LRGTQRQITRDRAALERQERQMEMEIKKMAKTGNREACKILAKQLVQLRKQKNRTYAVSS
ENSORLT00000019887_Oryzias.     LRGTQRQITRDRAALEKQEKQLELEIKKMAKSGNREACKILAKQLVQLRKQKNRTYAVSS
CR722600_Tetraodon.             MRSTQRQITRDRGALEKQEKQLEAEIKKMAKTGNKEACKILAKQLVQVRKQKCRTYAVSS
SINFRUT00000145644_Takifugu.    MRSTQRQIARDRGALEKQEKQLEAEIKKMAKTGNMGACKILAKQLVQLRQQKCRTYAVSS
                                :*.*** * *** ***:**:*:                                      

HIT000004639_Homo.           81 KVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE 140
XR_019694_Pan.                  KVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE
CR858910_Pongo.                 KVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE
XM_001104518_Macaca.            KVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE
BC055809_Mus.                   KVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE
XM_343995_Rattus.               ---------------------------TMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE
XM_544799_Canis.                KVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE
XM_001499808_Equus.             KVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKVDPQKTLQTMQNFQKENMKMEMTEE
BC104514_Bos.                   KVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE
ENSMODT00000021501_Monodelphis. KVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE
AJ851748_Gallus.                KVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE
BC067142_Danio.                 KVTSMSTQTKLMNSQMKMAGAMATTTKTMQAVNKKMDPKKTMQTLQNFQKETAKMDMTEE
NM_001123297_Danio.             KVTSMSTQTKVMNSQMKMAGAMSTTAKTMQTVNKRMDPKKTLQTMQDFQKENMKMGMTED
ENSORLT00000019887_Oryzias.     KVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLKTMQDFQKENMKMGMTED
CR722600_Tetraodon.             KVTSMSTQTQVMNSQMKMAGAMATTAKTMQAVNKKMDPQKTLKTMQDFQKENMKMGMTEE
SINFRUT00000145644_Takifugu.    KVTSMSTQTQVMNSQMKMAGAMATTAKTMQAVNKKMDPQKTLKTMQDFQKENMKMGMTED
                                                           ***:***::**:**::*:*:****. ** ***:

HIT000004639_Homo.          141 MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSAS--TSKA-T 197
XR_019694_Pan.                  MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSAS--TSKA-T
CR858910_Pongo.                 MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSAS--TSKA-T
XM_001104518_Macaca.            MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAAGSLPSAS--TSKA-T
BC055809_Mus.                   MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSAS--TSKA-T
XM_343995_Rattus.               MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSAS--TSKA-T
XM_544799_Canis.                MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSAS--TSKA-T
XM_001499808_Equus.             MINDTLDDIFDGSDEEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSAS--TSKA-T
BC104514_Bos.                   MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSAS--TSKS-T
ENSMODT00000021501_Monodelphis. MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARGLPSAS--TSKAST
AJ851748_Gallus.                MINDTLDDIFDASDEEEESQDIVNQVLDEIGIEISGKMAKAPSAARGLPSAS--TSKAST
BC067142_Danio.                 MMNDTLDEIFEDSGDEEESQDIVNQVLDEIGIEISGKMAHAPSAARKTPSAA--TAKADG
NM_001123297_Danio.             MLNSTLDEIFDESADEEECQDIVNQVLDEIGIEISGKMVRAPSTGKILPGASPAKSKTAT
ENSORLT00000019887_Oryzias.     MINDTLDEIFDESGDEEESEDIVSQVLDEIGIEISGKMIKAPAAGKSVPGAA-SSSKQAT
CR722600_Tetraodon.             MINDTLDDIFDESGDEEESQDIVNQVLDEIGIEISGKMVRAPAAGKTLPGAS--SSKQAN
SINFRUT00000145644_Takifugu.    MINDTLDDIFEGSGDEEESQDIVNQVLDEIGIEISGKMVKAPAAGKSLPGAT--SSKQAN
                                *:*.***:**: * :***.:***.************** :**::.   *.*:  .:*   

HIT000004639_Homo.          198 ISDEEIERQLKALGVD 213
XR_019694_Pan.                  ISDEEIERQLKALGVD
CR858910_Pongo.                 ISDEEIERQLKALGVD
XM_001104518_Macaca.            ISDEEIERQLKALGVD
BC055809_Mus.                   ISDEEIERQLKALGVD
XM_343995_Rattus.               ISDEEIERQLKALGVD
XM_544799_Canis.                ISDEEIERQLKALGVD
XM_001499808_Equus.             ISDEEIERQLKALGVD
BC104514_Bos.                   ISDEEIERQLKALGVD
ENSMODT00000021501_Monodelphis. ISDEEIERQLKALGVD
AJ851748_Gallus.                ISDEEIERQLKALGVD
BC067142_Danio.                 ISDEDIERQLKALGVD
NM_001123297_Danio.             ISDAEIERQLKALGMD
ENSORLT00000019887_Oryzias.     ISDDEIERQLRALGVD
CR722600_Tetraodon.             ITDDEIERQLRALGVD
SINFRUT00000145644_Takifugu.    ITDDEIERQLRALGVD
                                *:* :*****:***:*