Alignment of orthologs
Amino acid abbreviation

[View by Jalview] (requires Java)

HIT000004102_Homo.            1 -MAAAAEERMAEEGGGGQGDGGSSLASGSTQRQPPPPAPQHPQPGSQALPAPALAPDQLP 59
XM_001135277_Pan.               -MAAAAEERMAEEGGGGQGDGGSSLASGSTQRQPPPPAPQHPQPGSQALPAPALAPDQLP
ENSPPYT00000000200_Pongo.       -MAAAAEERMAEEGGGGQGDGGSSLASGSTQRQPPPPPPQHPQPGSQALPAPALAPDQLP
XM_001097187_Macaca.            MAAAAAEDRMAEEGGGSHGDGGSSLASGSTQRQPPPPPPQHPQPGSQALPAPALAPDQLP
BC094542_Mus.                   -MAAASEERMAEEGGGGHGDGGSCSAAGSAQRQPPAPPSQAPPPGSQAPAAPALAPDHLP
ENSRNOT00000000074_Rattus.      -MAAASEERMAEEGGGGHGDGGSCSAASSAQRQPPTPPSQALQPGSQAPAAPALAPDHLP
XM_849736_Canis.                -MAAASEERMAEEGGGGHGDGGPSSAVGSAQRLPPPPPPPAPQPGSQAPPAPALAPDQLP
XM_001915204_Equus.             -MAAASEERMAEEGGGGHGEGGSSRASGSAQRLPPPPPPQPPQPGSQAPPASALAPDQLP
BC111213_Bos.                   -MAAASEERMAEEGGGGHGDGGSPSAIASTQRLPPPPPPQPPQPGSQAPPAPALAPDQLP
XM_001367823_Monodelphis.       -MAAVTEEWMAEEGGGGSCGGGSSLAAGASQRLSPLPPPQPALLGPQSPASPSLALDQLP
ENSGALT00000015195_Gallus.      -KMAAAEERLLSEGEGG--------APGSA-RLSPPPLSQSPE-------APA-PLEQPP
                                   *.:*: : .** *.        * .:: * .* * .           :.: . :: *

HIT000004102_Homo.           60 QNNTLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQ 119
XM_001135277_Pan.               QNNTLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQ
ENSPPYT00000000200_Pongo.       QNNTLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQ
XM_001097187_Macaca.            QNNTLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQ
BC094542_Mus.                   QNNTLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERFHNLCQKQ
ENSRNOT00000000074_Rattus.      QNNTLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQ
XM_849736_Canis.                QNNTLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQ
XM_001915204_Equus.             QNNTLVALPIVAIENILSFMSYDEISHLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQ
BC111213_Bos.                   QNNTLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQ
XM_001367823_Monodelphis.       HNNTLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQ
ENSGALT00000015195_Gallus.      QSNTLMGLPIVAIESILSFLSYDETSQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQ
                                :.***:.*******.****:**** *:*************************:*******

HIT000004102_Homo.          120 VKAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYR 179
XM_001135277_Pan.               VKAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYR
ENSPPYT00000000200_Pongo.       VKAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYR
XM_001097187_Macaca.            VKAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYR
BC094542_Mus.                   VKAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYR
ENSRNOT00000000074_Rattus.      VKAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYR
XM_849736_Canis.                VKAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYR
XM_001915204_Equus.             VKAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYR
BC111213_Bos.                   VKAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYR
XM_001367823_Monodelphis.       VKAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYR
ENSGALT00000015195_Gallus.      VKAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYR
                                ************************************************************

HIT000004102_Homo.          180 VLRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVP 239
XM_001135277_Pan.               VLRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVP
ENSPPYT00000000200_Pongo.       VLRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVP
XM_001097187_Macaca.            VLRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVP
BC094542_Mus.                   VLRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVP
ENSRNOT00000000074_Rattus.      VLRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVP
XM_849736_Canis.                VLRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVP
XM_001915204_Equus.             VLRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVP
BC111213_Bos.                   VLRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVP
XM_001367823_Monodelphis.       VLRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKKKLPGSDVSGRLIGSPPVP
ENSGALT00000015195_Gallus.      VLRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLIGAAPVP
                                *****************************************:***********:*:.***

HIT000004102_Homo.          240 GPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQDQ 299
XM_001135277_Pan.               GPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQDQ
ENSPPYT00000000200_Pongo.       GPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQDQ
XM_001097187_Macaca.            GPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQDQ
BC094542_Mus.                   GPSAALTTMQLFSKQNPSRQEVTKLQQQVRTNGAGVTVLRREISELRTKVQEQQKQLQDQ
ENSRNOT00000000074_Rattus.      GPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQDQ
XM_849736_Canis.                GPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQDQ
XM_001915204_Equus.             GPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQDQ
BC111213_Bos.                   GPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQDQ
XM_001367823_Monodelphis.       GPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQDQ
ENSGALT00000015195_Gallus.      GPSAALTTMQLFSKQNPSRQEVTKLQQQVKANGAGVTVLKREISELRTKVQEQQKQLQDQ
                                *****************************::********:********************

HIT000004102_Homo.          300 DQKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLR 359
XM_001135277_Pan.               DQKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLR
ENSPPYT00000000200_Pongo.       DQKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLR
XM_001097187_Macaca.            DQKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLR
BC094542_Mus.                   DQKLLEQTQIIGEQNARLAELERKLREVMESAVGTSSGSGQSEESPRKRRKATEAIDSLR
ENSRNOT00000000074_Rattus.      DQKLLEQTQIIGEQNARLAELERKLREVMESAVGTSSGSGQSEESPRKRRKATEAIDSLR
XM_849736_Canis.                DQKLLEQTQIIGEQNARLAELERKLREVMESAVGSSSGSGANEESPRKRKKAAEAIDSLR
XM_001915204_Equus.             DQKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSGSGQNEESPRKRKKAAEAIDSLR
BC111213_Bos.                   DQKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSGSGQSEESPRKRKKAAEAIDSLR
XM_001367823_Monodelphis.       DQKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSGSGPNEESPRKRRKAVEAIDSLR
ENSGALT00000015195_Gallus.      DQKLLEQTQIIGEQNARLAELERKLREVMESAVGSSSGSGSNEQSPRKRRKAVESTDCPR
                                **********************************.***** .*:*****:**.*: *. *

HIT000004102_Homo.          360 KSKRLRNRK 368
XM_001135277_Pan.               KSKRLRNRK
ENSPPYT00000000200_Pongo.       KSKRLRNRK
XM_001097187_Macaca.            KSKRLRNRK
BC094542_Mus.                   KSKRLRNRK
ENSRNOT00000000074_Rattus.      KSKRLRNRK
XM_849736_Canis.                KSKRLRNRK
XM_001915204_Equus.             KSKRLRNRK
BC111213_Bos.                   KSKRLRNRK
XM_001367823_Monodelphis.       KSKRLRNRK
ENSGALT00000015195_Gallus.      KSKRLRNRK
                                *********