Alignment of orthologs
Amino acid abbreviation [ Alignment of gene family/group ]

[View by Jalview] (requires Java)

HIT000001184_Homo.            1 ------------MISAAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRF 48
XM_525271_Pan.                  ------------MISAAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRF
CR860404_Pongo.                 ------------MISPAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRF
XM_001084137_Macaca.            ------------MISPAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRF
BC052043_Mus.                   ------------MISPAWSLFLIGTKIGLFFQVAPLSVVAKSCPSVCRCDAGFIYCNDRS
XM_001080226_Rattus.            ------------MISPAWSLFLIGTKIGLFFQVAPLSVMAKSCPSVCRCDAGFIYCNDRS
XM_852855_Canis.                ------------MINPAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRF
XM_001491950_Equus.             ------------MISPAWSIFLIWTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRF
XM_001251706_Bos.               ------------MISPAWSIFLIGTKIGLFLQVAPLSVMAKPCPSVCRCDAGFIYCNDRF
ENSMODT00000006654_Monodelphis. KKIPGKTSTVLTMINPTWSIFLIWTKIGLFLKMAPQSVMAKSCPSVCRCDAGFIYCNDRA
BX934700_Gallus.                ------------MITVPWSVFLIWTKIGLLLDMAPYSVAAKPCPSVCRCDVGFIYCNDRD
CU468792_Danio.                 ------------MASNYMSFFVFFIRAGLLLGLANPLMTSASCPSQCRCDGTFIYCNDRD
GSTENT00030825001_Tetraodon.    ------------MVSQCKALILFLVRIGLLLGLANPLVTSASCPSACRCDGTFIYCNDRG
SINFRUT00000181189_Takifugu.    ------------MVRQCKALILFLIRIGLLQGLANPLVTSASCPSACRCDGTFIYCNDRG
                                            *     :.:::  : **:  :*   : : .*** ****  ******* 

HIT000001184_Homo.           49 LTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKE 108
XM_525271_Pan.                  LTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKE
CR860404_Pongo.                 LTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKE
XM_001084137_Macaca.            LTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKE
BC052043_Mus.                   LTSIPVGIPEDATTLYLQNNQINNVGIPSDLKNLLKVQRIYLYHNSLDEFPTNLPKYVKE
XM_001080226_Rattus.            LTSIPVGIPEDATTLYLQNNQINNVGIPSDLKNLLKVQRIYLYHNSLDEFPTNLPKYVKE
XM_852855_Canis.                LTSIPAGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKE
XM_001491950_Equus.             LTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKE
XM_001251706_Bos.               LTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKE
ENSMODT00000006654_Monodelphis. LTSIPKGIPEDATTLYLQNNQINNAGIPSELKNLLKVERIYLYHNSLDEFPTNLPKYVKE
BX934700_Gallus.                LTS-----------------------IPSELKNLRRVERIFLYHNSLDEFPTNLPKYVKE
CU468792_Danio.                 LTSIPSGIPEDATVLFLQNNRIKSAGIPTDLRRLNGVEKIYLYCNNLDEFPTNLPLNVKE
GSTENT00030825001_Tetraodon.    LTSIPTGMPQDATVLFLQNNRIKSSGIPAELRRLTNVEKIYLYCNNLDEFPTNLPLGLKE
SINFRUT00000181189_Takifugu.    LTAIPTGMPQDATVLFLQNNRIKSSGIPAELRQLNNVEKIYLYCNNLDEFPTNLPLGLKE
                                **:                       **::*:.*  *::*:** *.*********  :**

HIT000001184_Homo.          109 LHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLST 168
XM_525271_Pan.                  LHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLST
CR860404_Pongo.                 LHLQENNIRTITYDSLSKIPYLEELRLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLST
XM_001084137_Macaca.            LHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLST
BC052043_Mus.                   LHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLST
XM_001080226_Rattus.            LHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLST
XM_852855_Canis.                LHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLST
XM_001491950_Equus.             LHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLST
XM_001251706_Bos.               LHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLST
ENSMODT00000006654_Monodelphis. LHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEDGAFRDNNYLRLLFLSRNHLST
BX934700_Gallus.                LHLQENNIRTITYDSLSQIPYLEELHLDDNSVSAVSIEDGAFRDNIYLRLLFLSRNHLST
CU468792_Danio.                 LHLQENNIRTITHASLAQIPFIEELHLDDNSVSAVSIEEGAFRDSNHLRLLFLSRNHLST
GSTENT00030825001_Tetraodon.    LHLQENNVRMITHASLAQIPFIEELHLDDNSVSAVSIEEGAFRDSNHLRLLFLSRNHLST
SINFRUT00000181189_Takifugu.    LHLQENNVRMITHASLAQIPFIEELHLDDNSVSAVSIEEGAFRDSNHLRLLFLSRNHLSA
                                *******:* **: **::**::***:************:*****. :************:

HIT000001184_Homo.          169 IPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLT 228
XM_525271_Pan.                  IPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLT
CR860404_Pongo.                 IPWGLPRTIEELRLDDNRIPTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLT
XM_001084137_Macaca.            IPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLT
BC052043_Mus.                   IPGGLPRTIEELRLDDNRISTISSPSLHGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLT
XM_001080226_Rattus.            IPGGLPRTIEELRLDDNRISTISSPSLHGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLT
XM_852855_Canis.                IPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLT
XM_001491950_Equus.             IPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLT
XM_001251706_Bos.               IPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLT
ENSMODT00000006654_Monodelphis. IPWGLPRTIEELRLDDNRISTISSPSLQDLTSLKRLVLDGNLLNNHGLGDKVFMNLVNLT
BX934700_Gallus.                IPWGLPKTIEELRLDDNRISTISELSLQDLTNLKRLVLDGNLLNNHGLGDKVFMNLVNLT
CU468792_Danio.                 IPSGLPMTIEELRFDDNRISSISEASLQDLINLKRLVLDGNLLNNRGIGEMALVNLVNLT
GSTENT00030825001_Tetraodon.    IPSGLPTSIEELRFDDNRISSISEQSLQDLINLKRLILDGNLLNNRGIGEMAFINLINLT
SINFRUT00000181189_Takifugu.    IPSGLPTSIEELRFDDNRISSISEQSLQDLINLKRLILDGNLLNNRGIGEMAFINLINLT
                                ** *** :*****:*****.:**. **:.* .****:********:*:*: .:.**:***

HIT000001184_Homo.          229 ELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQ 288
XM_525271_Pan.                  ELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQ
CR860404_Pongo.                 ELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQ
XM_001084137_Macaca.            ELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQ
BC052043_Mus.                   ELSLVRNSLTAAPVNLPGTSLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQ
XM_001080226_Rattus.            ELSLVRNSLTAAPVNLPGTSLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQ
XM_852855_Canis.                ELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQ
XM_001491950_Equus.             ELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQ
XM_001251706_Bos.               ELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQ
ENSMODT00000006654_Monodelphis. ELSLVRNSLTAAPVNLPGTNLRKLYLQENHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQ
BX934700_Gallus.                ELSLVRNSLTAAPVNLPGTNLRKLYLQENHINHVPPNAFSYLRQLYRLDMSNNNLSNLPQ
CU468792_Danio.                 ELSLVRNSLTSPPANLPGSSLEKLNLQDNHINHVPPGAFAFLRQLYRLDLSGNNLSSLPM
GSTENT00030825001_Tetraodon.    ELSLVRNSLTAPPANLPGTSLEKLQLQDNHINRVPPGAFAFLRQLYRLDLSGNNLSSLPQ
SINFRUT00000181189_Takifugu.    ELSL---------------------LQDNHINRVPPGAFAFLRQLYRLDLSGNNLSSLPQ
                                ****                     **:****:***.**::********:*.****.** 

HIT000001184_Homo.          289 GIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDL 348
XM_525271_Pan.                  GIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDL
CR860404_Pongo.                 GIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDL
XM_001084137_Macaca.            GIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDL
BC052043_Mus.                   GIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDL
XM_001080226_Rattus.            GIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDL
XM_852855_Canis.                GIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPMKVNVRGLMCQAPEKVRGMAIKDL
XM_001491950_Equus.             GIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPMKVNVRGLMCQAPEKVRGMAIKDL
XM_001251706_Bos.               GIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDL
ENSMODT00000006654_Monodelphis. GIFDDLDNITQLFLRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDL
BX934700_Gallus.                GVFDDLDNITQLFLRNNPWHCGCKMKWVRDWLQSLPLKVNVRGLMCQAPEKVRGMAIKDL
CU468792_Danio.                 GVFEDLDNLTQLLLRNNPWHCNCRMKWVRDWLRTLPSKVNVRGFMCQGPDKVKGMAIKDL
GSTENT00030825001_Tetraodon.    GVFEDLDNLTQLLLRNNPWQCTCRMKWVRDWLRSLPTKVNVRGFMCQGPDKVKGMAIKDL
SINFRUT00000181189_Takifugu.    GVFEDLDNLTQLLLRNNPWQCTCRMKWVRDWLRSLPTKVNVRGFMCQGPDKVKGMAIKDL
                                *:*:****:***:****** * *:********::** ******:***.*:**:*******

HIT000001184_Homo.          349 NAELFDCKDSGIVSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPS- 407
XM_525271_Pan.                  NAELFDCKDSGIVSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPS-
CR860404_Pongo.                 NAELFDCKDSGIVSTIQITTAIPNTVYPAQEQWPAPVTKQPDIKNPKLTKDHQTTGSPS-
XM_001084137_Macaca.            NAELFDCKDSGIVSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPS-
BC052043_Mus.                   SAELFDCKDSGIVSTIQITTAIPNTAYPAQGQWPAPVTKQPDIKNPKLIKDQRTTGSPS-
XM_001080226_Rattus.            SAELFDCKDSGIVSTVQITTAIPNTAYPAQGQWPAPVTKQPDIKNPKLTKDQRTTGSPS-
XM_852855_Canis.                NAELFDCKDSAVVSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDQRTTGSPA-
XM_001491950_Equus.             NAELFDCKDSAVVSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDQRTTGSPS-
XM_001251706_Bos.               NAELFDCKDNPVVSTIQITTGTPNTVHPAQGQWPAPVTKQPDTKNPKLTKDQRTTGIPS-
ENSMODT00000006654_Monodelphis. NTELFDCKDSGIVSTIQITTAIPNTLYPAQGQKPVSVTKQSEVKNPKLNKDYRTTVSPM-
BX934700_Gallus.                NAELFDCKDD--MSTIQITTAVPNTLYPAQGHWPVSVTKQPDIKTPNLNKNYRTTASPV-
CU468792_Danio.                 STELFGCSDTEIPTTYE-TSTVSNTLPPSRPQWPSYVTKRPVVKGPDLGRNYRSTTPSS-
GSTENT00030825001_Tetraodon.    TTDMFDCTDTELNPTYE-ASTVANVLRPSQPHWPLFVTRRPVLNRPDAGKNFHSTTTSSG
SINFRUT00000181189_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000001184_Homo.          408 RKTITITVKSVTSDTIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVT 467
XM_525271_Pan.                  RKTITITVKSVTSDTIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVT
CR860404_Pongo.                 RKTITITVKSVTSDTIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVT
XM_001084137_Macaca.            RKTITITVKSVTSDTIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVT
BC052043_Mus.                   RKTILITVKSVTPDTIHISWRLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVT
XM_001080226_Rattus.            RKTILITVKSVTPDTIHISWRLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVT
XM_852855_Canis.                RKTIIITVKSVTSDTIHISWKLVLPMTALRLSWLKLGHSPASGSITETIVTGERNEYLVT
XM_001491950_Equus.             RKTIIITVKSVTSDTIHISWKLVLPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVT
XM_001251706_Bos.               RKTITITVKSVTSDTIHISWKLVLPMTALRLSWLKLDHSPAFGSITETIVTGERSEYLVT
ENSMODT00000006654_Monodelphis. RKIITITVKSVSTETIRISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGDRNEYLVT
BX934700_Gallus.                RKIITIFVKSVSTETIHISWKVALPMTALRLSWLKMGHSPAFGSITETIVTGDRSDYLLT
CU468792_Danio.                 RKIITISVKSSSAETVHISWRVSQPMTALRLSWLKLGHSPAFGSITETIVQGERTEYLLT
GSTENT00030825001_Tetraodon.    RKIITISVKSSSADTIHISWRISQPMTALRLSWLKLGHSPAFGSITETIVQGERREYLLT
SINFRUT00000181189_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000001184_Homo.          468 ALEPDSPYKVCMVPMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNL 527
XM_525271_Pan.                  ALEPDSPYKVCMVPMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNL
CR860404_Pongo.                 ALEPDSPYKVCMVPMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNL
XM_001084137_Macaca.            ALEPDSPYKVCMVPMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNL
BC052043_Mus.                   ALEPESPYRVCMVPMETSNLYLFDETPVCIETQTAPLRMYNPTTTLNREQEKEPYKNPNL
XM_001080226_Rattus.            ALEPESPYRVCMVPMETSNLYLFDETPVCIETQTAPLRMYNPTTTLNREQEKEPYKNPNL
XM_852855_Canis.                ALEPDSPYRVCMVPMETSNLYLFDDTRVCIETETAPLRMYNPTTTLNREQEKEPYKNPNL
XM_001491950_Equus.             ALEPDSPYRVCMVPMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNL
XM_001251706_Bos.               ALEPDSPYRVCMVPMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNL
ENSMODT00000006654_Monodelphis. ALEPDSPYRICMVPMETSNLYLSDETPVCIETETAPLKMYNPTTTLNREQEKEPYKNSNL
BX934700_Gallus.                ALEPESPYRVCMVPMETSNIYLSDETPECIETETAPLKMYNPTTTLNREQEKEPYKNSSV
CU468792_Danio.                 ALEPESSYRICMVPMETSNIYLSDETPVCIETETGSLKAYNPTTTLNREQEKEPYKNSNL
GSTENT00030825001_Tetraodon.    ALEPESAYRICMVPMETSNIYLSDETPVCIETETGPHKSYNPTTTLNREQEKEPYKNSSL
SINFRUT00000181189_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000001184_Homo.          528 PLAAIIGGAVALVTIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSIL 587
XM_525271_Pan.                  PLAAIIGGAVALVTIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSIL
CR860404_Pongo.                 PLAAIIGGAVALVTIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSIL
XM_001084137_Macaca.            PLAAIIGGAVALVTIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSIL
BC052043_Mus.                   PLAAIIGGAVALVSIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSIL
XM_001080226_Rattus.            PLAAIIGGAVALVSIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSIL
XM_852855_Canis.                PLAAIIGGAVALVTIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSIL
XM_001491950_Equus.             PLAAIIGGAVALVTIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSIL
XM_001251706_Bos.               PLAAIIGGAVALVTIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSIL
ENSMODT00000006654_Monodelphis. PLAAIIGGAVALVAIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSIL
BX934700_Gallus.                PLAAIIGGAVALVALALLALVCWYVHRNGALFSRHCAYSKGRRRKDDYAEAGTKKDNSIL
CU468792_Danio.                 P-----------------------------------------------------------
GSTENT00030825001_Tetraodon.    PLAAIIGGAVALLAIIMLALVCWYVHRNGSLFSRNCTYNKGRRRKDDYAEAGTKKDNSIL
SINFRUT00000181189_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000001184_Homo.          588 EIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESS-SNRSYRDSGIPDSDH 646
XM_525271_Pan.                  EIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESS-SNRSYRDSGIPDSDH
CR860404_Pongo.                 EIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESS-SNRSYRDSGIPDSDH
XM_001084137_Macaca.            EIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESS-SNRSYRDSGIPDSDH
BC052043_Mus.                   EIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNLSESS-SNRSYRDSGIPDSDH
XM_001080226_Rattus.            EIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNLSESS-SNRSYRDSGIPDLDH
XM_852855_Canis.                EIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESS-SNRSYRDSGIPDSDH
XM_001491950_Equus.             EIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESS-SNRSYRDSGIPDSDH
XM_001251706_Bos.               EIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESS-SNRSYRDSGIPDSDH
ENSMODT00000006654_Monodelphis. EIRETSFQMLPINNEPISKEEFVIHTIFPPNGINLYKSNHSESS-SNRSYRDSGIPDSDH
BX934700_Gallus.                EIRETSFQMIPITNDQVSKEEFVIHTIFPPNGMNLYKNSHSESS-SNRSYRDSGIPDSDH
CU468792_Danio.                 ------------------------------------------------------------
GSTENT00030825001_Tetraodon.    EIRETSFQMIPINHLPVSKEEFVIHTIFPPNGLSLYKSPHSENSINNRSYRDSGIPDSDH
SINFRUT00000181189_Takifugu.    ------------------------------------------------------------
                                                                                            

HIT000001184_Homo.          647 SHS 649
XM_525271_Pan.                  SHS
CR860404_Pongo.                 SHS
XM_001084137_Macaca.            SHS
BC052043_Mus.                   SHS
XM_001080226_Rattus.            SHS
XM_852855_Canis.                SHS
XM_001491950_Equus.             SHS
XM_001251706_Bos.               SHS
ENSMODT00000006654_Monodelphis. SHS
BX934700_Gallus.                SHS
CU468792_Danio.                 ---
GSTENT00030825001_Tetraodon.    SHS
SINFRUT00000181189_Takifugu.    ---